KEGG   Sus scrofa (pig): 100525313
Entry
100525313         CDS       T01009                                 

Gene name
NPM1
Definition
(RefSeq) nucleophosmin
  KO
K11276  nucleophosmin 1
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100525313 (NPM1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Nucleoplasmins
     100525313 (NPM1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100525313 (NPM1)
SSDB
Motif
Pfam: Nucleoplasmin NPM1-C SDA1 Nop14 TFIIF_alpha NOA36 CDC45
Other DBs
NCBI-GeneID: 100525313
NCBI-ProteinID: XP_013846116
Ensembl: ENSSSCG00000016998
UniProt: I3LUP6 A0A4X1U7Y6
Position
16
AA seq 294 aa
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDEDDDEDDDDDDEDDDDD
DFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggaagattcgatggatatggacatgagccccctgaggcctcagaactatcttttcggt
tgtgaactaaaggccgataaagattaccactttaaggtggataatgatgaaaatgagcac
cagttatctttaagaacggtcagtttaggggctggcgcaaaggatgagttgcacattgta
gaagcagaggcaatgaattatgaaggcagtccaatcaaagtaacactggcaactttgaaa
atgtctgtacagccgacggtttcccttgggggctttgaaataacaccacctgtggtctta
cggttgaagtgtggttcagggcctgtgcatattagtggacagcacttagtagctgtagag
gaagatgcagagtcagaagatgaggaggaggaagatgtgaaacttctgagtatatctgga
aagcgttctgcccccggaggtggtagcaaggttccacagaaaaaggtaaaacttgctgct
gatgaagatgaagatgatgatgaagatgatgacgacgatgacgaagatgacgatgatgat
gactttgatgatgaggaagcggaagaaaaagctccagtaaagaaatcaatacgggatact
ccagccaaaaatgcacagaaatcaaaccagaatggaaaagactcaaaaccgtcaacacca
agatcaaaaggtcaagaatccttcaaaaaacaggaaaaaactcctaaaacaccgaaagga
cctagttctgtagaagacattaaagcaaaaatgcaagcaagtatagaaaaaggtggttct
cttcccaaagtggaagccaagttcatcaattatgtgaagaattgtttccggatgactgac
caggaggctattcaagatctctggcagtggaggaagtctctttaa

DBGET integrated database retrieval system