KEGG   Sus scrofa (pig): 100525351Help
Entry
100525351         CDS       T01009                                 

Gene name
RASSF6
Definition
(RefSeq) ras association domain-containing protein 6
  KO
K09854  Ras association domain-containing protein 6
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04390  Hippo signaling pathway
ssc04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100525351 (RASSF6)
   04392 Hippo signaling pathway - multiple species
    100525351 (RASSF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2 YusW
Motif
Other DBs
NCBI-GeneID: 100525351
NCBI-ProteinID: XP_005666797
Ensembl: ENSSSCG00000008952
UniProt: F1RUL8 A0A4X1T5D0
Position
8
AA seq 337 aa AA seqDB search
MTMMAHEASSWIFINERTFITREQLNSLLKTYNIFYRNQENLHILYGQTEDGKLIVEGLL
DIFWGVKRPLQLKIQDEKQIPSFTALKSPDVFSKRGMTRWGEFDDLHRISDLDRTQIPVS
EATNSQEDYLSYQCSTLKPHTDEEPESPLLYRTMSEAALVRKRMKPPMMDRKARQKHRAS
INGHIYNHETSIFTPAFGSETKVRINSDMRTEEVIKQILQKFKIENSAQDFALYIIFSTG
EQRRLKKTDIPLLHRLLQGPSKKNARIFLMDKDAEEISSDVAQYINFHFSLLESILQRLN
EEEKREIQRTIIKFRTEKAIILKYLQSKRVIKTETTV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactatgatggctcacgaggcctcttcttggatcttcatcaatgagagaacgttcatt
accagggaacaactgaattctttattgaagacctataacatcttttataggaatcaggaa
aatctgcatattttatatggacagactgaagatggtaaactaattgtggaagggctgttg
gacattttctggggagtaaagcgccctctacaactgaaaatacaagatgagaagcagatc
ccatcttttactgcgctaaagtcaccggatgtcttttccaaaaggggaatgacacgctgg
ggagaatttgatgatcttcatcgaattagtgatttggacaggactcagattccagtgtct
gaagcaacaaattcccaggaagattatttatcttaccagtgtagcactctgaagcctcat
acagatgaagagcctgaatccccgctactgtatagaaccatgagtgaagcagccctggtg
aggaaaaggatgaagcctccaatgatggacagaaaagccagacagaaacatagggcctct
attaatggacacatttataaccatgaaacatcaatattcactccagcctttggatcagaa
actaaggtcagaataaacagtgatatgagaactgaagaagtaataaagcagattctccaa
aaatttaagattgaaaatagtgcccaggattttgcactttacattattttttcaacagga
gagcagagacggctaaagaagacagacattccgctactgcacagactcctacagggacct
tccaaaaagaacgctcgcattttcctcatggacaaagatgcagaagaaattagcagtgat
gtggctcagtatattaactttcatttttctctcctggaatccatccttcaaagattaaat
gaagaggagaaaagagagattcaaagaacaataataaaattcaggacagaaaaggctatc
atcctgaaatatcttcaaagtaaacgggtaataaaaacagagacaacagtttag

DBGET integrated database retrieval system