KEGG   Sus scrofa (pig): 100525674Help
Entry
100525674         CDS       T01009                                 

Gene name
RAB9B
Definition
(RefSeq) ras-related protein Rab-9B
  KO
K07900  Ras-related protein Rab-9B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05132  Salmonella infection
ssc05162  Measles
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100525674 (RAB9B)
  09172 Infectious disease: viral
   05162 Measles
    100525674 (RAB9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100525674 (RAB9B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ssc04031]
    100525674 (RAB9B)
Membrane trafficking [BR:ssc04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    100525674 (RAB9B)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    100525674 (RAB9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_7 AAA_16
Motif
Other DBs
NCBI-GeneID: 100525674
NCBI-ProteinID: XP_003135320
Ensembl: ENSSSCG00000025890
Vega: OTTSUSG00000004754
UniProt: A0A4X1W519 A0A287BH53
Position
X
AA seq 201 aa AA seqDB search
MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQI
WDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFV
VLGNKVDKEDRQVTTEEAQAWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLE
HCMLGHTVDLNSGSKAGSSCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaaatcactgctcttaaaggtcattcttttgggtgatggtggagttgggaaa
agctcgctcatgaaccgttatgtaaccaataaatttgactcccaggcttttcacaccata
ggggtagagttcttaaatcgagatctggaggtagatggacgctttgtaactctccagata
tgggacactgcagggcaggaacgtttcaagagccttaggacacccttctacagaggggca
gactgctgcctcttgaccttcagcgtggatgaccggcagagctttgagaacctcggtaat
tggcagaaagaattcatctactacgcagatgtgaaagaccctgagcacttcccctttgta
gttctgggtaacaaggtagacaaagaggataggcaagtgactactgaggaggcacaggcc
tggtgcatggagaatggagattacccttatcttgaaacaagtgccaaagatgatactaat
gtgacagtggcctttgaagaagctgtcaggcaggtgttagctgtagaggaacagctggag
cattgcatgttaggtcacactgttgacttgaacagtggctccaaagcagggtcttcatgc
tgttaa

DBGET integrated database retrieval system