KEGG   Sus scrofa (pig): 100525800Help
Entry
100525800         CDS       T01009                                 

Gene name
SLITRK4
Definition
(RefSeq) SLIT and NTRK-like protein 4
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 TPKR_C2 LRRNT LRR_1
Motif
Other DBs
NCBI-GeneID: 100525800
NCBI-ProteinID: XP_003135482
Ensembl: ENSSSCG00000022091
Vega: OTTSUSG00000004907
UniProt: F1RQ64
Position
X
AA seq 838 aa AA seqDB search
MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSN
FYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALKQLHLNNNELK
ILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASL
THLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEA
ICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENSYTTPNGHTTQTSLHRLV
TKPPKTTNPSKISGIVAGKGLSTRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVN
CQEKNIQSMSELIPKPFNAKKLHVNGNSIKDVDISDFAEFEGLDLLHLGSNQIAAIKGDV
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYL
NNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLV
ALKLWLEKLNDGIVVKELRCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPIPAVTF
TTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLANPE
CGSMQLQLRKHEHKSNKKDGLATEAFIPQTIEQMSKSHTCGLKESETGFMFADPPGQKVM
MRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIR
YPEKQQDKKTKKSLIGGNHSKIVVEQRKSSEYFELKAKLQSSPDYLQVLEEQTALNKI
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttggctctttctgattttgtcagccctgatttcttcaacaaatgcagattct
gacatatcggtggagatttgcaatgtgtgttcctgcgtgtccgttgagaatgtgctctat
gtcaactgtgagaaggtttccgtctacaggccaaatcagctgaaacccccttggtctaat
ttttatcacctcaatttccaaaataattttttaaacatcctctacccaaatacattcttg
aatttttcacacgcagtctccctgcagctgggaaataataaactgcagaacattgaggga
ggagccttccttgggctcagtgcattaaagcagttgcacttgaacaacaatgaattaaag
attctccgtgctgacactttccttggcattgagaacttggagtatctccaggctgactac
aatttaatcaagtatattgaacgaggagccttcaataagctccacaaactgaaagttctc
attcttaatgacaatctgatttcattccttcctgataatattttccgattcgcctctttg
acccatctggatatacgagggaacaggatccagaagctgccctatatcggggtcctggaa
cacataggccgtgtggtcgaactacaactggaagataacccttggaactgtagctgtgat
ctgctgcctttaaaagcttggctggagaatatgccctataacatttacataggagaggcc
atctgtgaaactcccagcgacttatatggaaggcttttgaaggaaaccaacaagcaggaa
ctatgccccatgggcacaggcagtgattttgacgtgcggatcctgcctccgtctcagctg
gaaaacagctacaccactcccaatggtcatactacccagacgtccttgcacagattagtg
accaaaccaccaaaaacgacaaacccttccaagatctctggcattgtggcaggcaaaggc
ctctccacgcgcaatctcagccagattgtgtcttaccaaaccagggtgcctcccctgaca
ccttgcccggccccttgcttctgcaaaacccatccttcggacctggggctgagtgtcaac
tgccaagagaaaaacatccagtccatgtctgaactgataccgaaacctttcaatgccaag
aagctgcatgtcaatggcaacagcatcaaggatgtggacatctccgactttgctgagttt
gagggactggatctgcttcatttaggcagcaatcagattgcagccatcaagggagacgtg
ttccacaacctcacaaatttacgcaggctctatctcaatggcaaccagattgaaagactc
tacccagagattttttcaggcctccataacctacagtatctgtacttggaatacaacttg
attaaggaaatcttagcaggcacctttgactccatgccaaatttgcagctcctgtactta
aacaataatctcttaaagagcctgccagtttacatcttctctggagcccccctggcgaga
ctgaacctgaggaacaacaaattcatgtacctcccggtcagcggggtcctggatcagctg
cagtcccttacacagattgacttggagggcaacccctgggactgcacttgtgacttggtg
gcgttaaagctctggctggagaagctgaacgacgggatcgtcgtgaaagaactgaggtgc
gagaccccagtgcagtttgccaacatcgagctgaagtccctcaaaaatgaaatcttatgt
cccaaactcctaaacaagccatcagcgcccttcacgagccccatccctgccgtgacattc
accaccccgctggggcccatccgaagtcctcccggtggtccagtgcctctgtccatttta
atcctcagcatcttagtggtcctcatcctaactgtgtttgttgctttctgcctcctcgtt
tttgtgctgagacgaaacaagaaacctaccgtcaagcacgaaggcctggcgaaccctgag
tgtggctccatgcaactgcagctgaggaagcatgagcacaaaagcaacaaaaaagacgga
ctggccacggaagccttcatcccacaaaccatagaacagatgagcaagagccacacctgt
ggcttgaaagaatccgaaactgggttcatgtttgcagatcctccgggacagaaagtcatg
atgagaaacgttgccgacaaggagaaagatttgttgcatgtggacaccaggaagagactg
agtacaatcgatgagctggacgagctattccccagcagggattccaatgtgtttattcag
aattttctggaaagtaaaaaggagtacaatagcataggcgtcagcggcttcgagatccgc
tacccagagaaacaacaagacaaaaaaaccaagaagtcattgatagggggcaaccacagt
aaaattgttgtggaacaaaggaagagcagtgagtattttgaactaaaggcaaaactccag
agttcccccgactacctacaggtccttgaggagcagacagctttgaacaagatctag

DBGET integrated database retrieval system