KEGG   Sus scrofa (pig): 100526140
Entry
100526140         CDS       T01009                                 

Gene name
SPCS3
Definition
(RefSeq) signal peptidase complex subunit 3
  KO
K12948  signal peptidase complex subunit 3 [EC:3.4.-.-]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03060  Protein export
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    100526140 (SPCS3)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     100526140 (SPCS3)
SSDB
Motif
Pfam: SPC22
Other DBs
NCBI-GeneID: 100526140
NCBI-ProteinID: XP_003133368
Ensembl: ENSSSCG00000015769
UniProt: A0A4X1VWP5
Position
15
AA seq 180 aa
MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRER
SDLGFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLL
KDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaacacggtgctgtcgcgggcgaactcgttgttcgccttctcgctgagcgtgatggcg
gcgctcactttcggctgtttcatcaccaccgccttcaaagaccggagcgtcccggtgcgg
ctgcacgtctctcggatcatgctaaaaaatgtagaagacttcactggacctagagaaaga
agtgatcttggattcattacttttgatataactgctgatctagaaaatatatttgattgg
aatgttaagcagttgtttctttatttatcagcagaatattcaacaaaaaataatgccctg
aaccaagttgtcctttgggacaagattgttctgaggggtgataatccgaagctgctgttg
aaagatatgaaaacaaagtattttttctttgacgatggaaatggtctcaagggaaacagg
aatgtcactttaaccctatcttggaatgttgtaccaaatgctggaattctacctcttgtg
acaggatcaggacatgtgtctgtcccatttccagatacatatgaaataacgaagagttat
taa

DBGET integrated database retrieval system