KEGG   Sus scrofa (pig): 100620758
Entry
100620758         CDS       T01009                                 

Gene name
KCND1
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 1 isoform X1
  KO
K04891  potassium voltage-gated channel Shal-related subfamily D member 1
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100620758 (KCND1)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100620758 (KCND1)
SSDB
Motif
Pfam: Ion_trans DUF3399 BTB_2 Ion_trans_2 Shal-type BTB_3 PKD_channel
Other DBs
NCBI-GeneID: 100620758
NCBI-ProteinID: XP_005673658
Ensembl: ENSSSCG00000028284
UniProt: A0A5G2QNS8
Position
X
AA seq 648 aa
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGPARRPPREQPCGERFPLAFFCTDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNEDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCLRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQALGPGGLLSSCCPRRSKRR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGSGSGASSTLRNSSLGTPCLLPETVKISSL
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggcggcaggcgtggccacgtggctgccttttgcgcgggcggccgcggtgggctggctg
cccctggcccagcagcccctgcccccggcgccgggggtgaaggcatcgcgaggggatgag
gttctggtggtgaacgtgagcggccggcgctttgagacctggaagaacacgctggatcgc
tacccagacaccctgctgggcagttcagagaaagaattcttctatgacgcagactcgggc
gagtatttctttgatcgggacccggacatgttccggcacgtgctgaacttctaccgcacg
ggccgactgcactgcccgcggcaggagtgcatccaggccttcgacgaagagctggctttc
tatggcctggtgcccgagctcgtgggcgactgctgcctcgaagagtaccgggaccgcaag
aaggagaacgccgagcgcctggcggaggacgaggaggccgagcaggccggggacggcccg
gccctgccggccggcagctccctgcggcagcggctctggcgggccttcgagaacccccac
acgagcaccgcggccctggttttctactatgtcaccggctttttcatcgccgtgtcggtc
atcgccaacgtggtggagaccattccgtgtcgcggccctgcgcggcggcccccgagggag
cagccctgcggcgagcgctttccgctagcctttttctgcacggacacggcctgcgtgctc
atattcacgggggaatacctcctgcggctgttcgccgcccccagccgctgccgcttcctg
cggagcgtgatgagcctcatcgacgtggtggccattctgccctactacatcggactcttc
gtgcccaagaacgaggatgtctcgggcgcctttgtcaccctgcgcgtgttccgggtgttc
cgaatcttcaagttctccaggcactcacagggcttgaggattctgggctacacgctcaag
agctgtgcctcggagctgggcttcctcctcttttcccttaccatggccatcatcatcttc
gctactgtcatgttttatgccgagaagggcacaaacaagaccaactttaccagcatcccc
gcagccttctggtataccattgtcaccatgaccacacttggctatggagacatggtgccc
agcaccatcgctggcaagattttcggatccatctgctcactcagtggcgtcttggtcatt
gccctgcctgtgccagtcatcgtgtccaactttagccgcatctaccaccagaaccagcgt
gctgacaagcgccgagcgcagcagaaggtgcgcttggccaggatccggttggcaaagagt
ggtaccaccaacgccttcctgcagtacaagcagaacgggggccttgaggacagtggcagt
ggggaggaacaggcgctgtgtctcaggaaccgttctgctttcgagcagcaacatcaccac
ttgctgcactgtctagagaagaccacgtgccatgagttcacggacgagctaactttcagc
gaggccctgggcgccgtctcgctgggtggccgcaccagccgcagcacctccgtgtcctcc
caggccctggggcctggcggcctgctgtcctcttgctgcccccgcaggtccaagcgccgt
gccatccgcctggccaactccacagcctcggtcagccggggcagcatgcaggagctggac
acgctggcggggctgcggaggagccctgcccctcagagccgctcaagcctcaatgccaag
ccccatgacagccttgacctgaactgcgacagccgggacttcgtggctgccatcatcagt
atccccacccctcctgccaacaccccagatgagagccaaccttcctcccctggtggtagt
ggcagtggggccagcagcaccctcaggaactccagcctgggtaccccttgccttctgccc
gagactgtcaagatctcttccctgtga

DBGET integrated database retrieval system