KEGG   Sus scrofa (pig): 100620947
Entry
100620947         CDS       T01009                                 

Gene name
SREK1IP1
Definition
(RefSeq) protein SREK1IP1 isoform X1
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: zf-CCHC_3 zf-CCHC TP53IP5
Other DBs
NCBI-GeneID: 100620947
NCBI-ProteinID: XP_003359837
Ensembl: ENSSSCG00000029340
UniProt: A0A5G2R5N7 A0A4X1UT93
Position
16
AA seq 155 aa
MAVPGCNKDNVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEESDEENEELN
KLQALQEKRISEEEEKKKAKSKEKIKLKKKRKRSYSSSSTEEDTSRQKKQKYQKKEKKKE
KKNKSKKGKHHKKDKKKRKKEKHSSTSNSSEISKK
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcagttccaggttgcaacaaggacaatgttcgagcaggctgtaaaaaatgtggctac
cctggtcacctgacttttgaatgccgcaattttctccgagtagacccaaaaagggacata
gttttggatgttagcagcacaagcagtgaagagagtgatgaagagaatgaagaactgaat
aaattgcaggcattacaagaaaaaagaataagtgaagaagaggagaagaaaaaagcaaaa
agcaaagagaaaatcaagttgaaaaaaaaaagaaaaaggtcttattcatccagttccact
gaagaggatacttcaagacaaaagaaacaaaaatatcagaagaaagaaaagaaaaaagag
aaaaagaataagtcaaaaaaggggaagcatcacaaaaaggacaaaaagaagagaaaaaag
gaaaagcattcctcaacttctaatagttctgaaatctccaaaaagtaa

DBGET integrated database retrieval system