KEGG   Sus scrofa (pig): 100621746Help
Entry
100621746         CDS       T01009                                 

Gene name
RAB42
Definition
(RefSeq) putative Ras-related protein Rab-42
  KO
K07929  Ras-related protein Rab-42
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ssc04031]
    100621746 (RAB42)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    100621746 (RAB42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 AAA_22 TniB SRPRB Rubis-subs-bind
Motif
Other DBs
NCBI-GeneID: 100621746
NCBI-ProteinID: XP_003356293
Ensembl: ENSSSCG00000030432
UniProt: I3LMP5 A0A4X1TFU0
Position
6
AA seq 219 aa AA seqDB search
MEAGGFRYQFRIALLGDTAVGKTSLLRRYVADAPWIPEPEPELESAPTVGVEFYSRTLQL
RAGPRVKLQLWDTAGQERFRCITRSFYRNVVGVLLVFDVTNRKSFEHIRDWHQEVMATQG
PDKAIFLLVGHKSDLQSMRCVSAQEAEELAASLGMAFVETSAKNNCNVDLAFNTVADAIQ
QALQQGDIKLEEDWGGVRLINTQPPRPLSRKQHPGPCQC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgggggcttccgctaccagtttcggatcgcgctgctgggggacacggctgtg
ggcaagacgtcgttgctgcggcgctacgtggcggacgcgccttggataccagagcccgag
ccggagctcgagtcggcgcccacggtgggcgtcgagttctacagccgcactctacagctg
cgggccgggccgcgcgtcaagctgcagctttgggacactgcgggccaggagcgcttcagg
tgcatcaccaggtccttttaccggaatgtggtgggtgtcctgctggtctttgatgtgaca
aacaggaagtcctttgaacatatccgagactggcaccaggaggtcatggccactcagggc
cccgacaaggcgatcttcctgctggttggccacaagagtgacctgcagagcatgcgatgt
gtctcagcccaggaggcggaagagctggctgcctccctgggcatggccttcgtggagacc
tccgccaaaaataactgcaatgtggatctggccttcaacaccgttgctgatgccatccag
caggccctgcagcagggggacatcaagctggaggaggactgggggggtgtccggctcatc
aacacccaaccccccaggcccctcagcaggaagcagcatccgggcccatgccagtgttga

DBGET integrated database retrieval system