KEGG   Sus scrofa (pig): 100621853
Entry
100621853         CDS       T01009                                 

Gene name
RAB38
Definition
(RefSeq) ras-related protein Rab-38
  KO
K07923  Ras-related protein Rab-38
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100621853 (RAB38)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ssc04031]
    100621853 (RAB38)
Membrane trafficking [BR:ssc04131]
 Others
  Rab GTPases of specific organelles
   Melanosome
    100621853 (RAB38)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    100621853 (RAB38)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA TniB MMR_HSR1 AAA_22 AAA_7 PduV-EutP RnlB_antitoxin TsaE
Other DBs
NCBI-GeneID: 100621853
NCBI-ProteinID: XP_003482633
Ensembl: ENSSSCG00000014923
UniProt: A0A4X1U326 A0A287BFW9
Position
9
AA seq 211 aa
MQVPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVR
LQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVTKWKNDLDSKLSLPNGKPV
SVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILAN
ECDLMESIEPDIVKPHLTSPRAVSCSSCAKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggtcccgcacaaggagcacctgtacaagctgctagtgattggtgacctgggcgtg
ggcaagaccagcatcatcaaacgctatgtgcaccagaacttctcctcgcactaccgggcc
accatcggcgtggacttcgcgctcaaagtgctccactgggacccggagaccgtggttcgc
ctgcagctctgggacattgcaggtcaagaaagatttggaaacatgacaagggtctattac
cgagaagccatgggtgcatttattgtcttcgatgtcaccaggccagctacatttgaagca
gtgacaaagtggaagaatgatttggactcaaagttaagtctccctaatggcaaaccagta
tcagtggttttgttggccaacaaatgtgaccaggggaaggatgtgctcatgaacaatggc
ctcaagatggaccagttctgcaaggagcatgggtttgtaggatggtttgaaacatcagca
aaggaaaatataaacattgatgaagcctccagatgcctggtgaaacatatacttgcaaac
gaatgtgacctgatggagtccattgagcctgacattgtgaagccccatctcacatcgccc
agggctgtcagctgctccagctgtgccaaatcctag

DBGET integrated database retrieval system