KEGG   Sus scrofa (pig): 100621969
Entry
100621969         CDS       T01009                                 

Gene name
PSMB1
Definition
(RefSeq) proteasome subunit beta type-1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03050  Proteasome
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100621969 (PSMB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100621969 (PSMB1)
   05012 Parkinson disease
    100621969 (PSMB1)
   05014 Amyotrophic lateral sclerosis
    100621969 (PSMB1)
   05016 Huntington disease
    100621969 (PSMB1)
   05017 Spinocerebellar ataxia
    100621969 (PSMB1)
   05020 Prion disease
    100621969 (PSMB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100621969 (PSMB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100621969 (PSMB1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ssc03051]
    100621969 (PSMB1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     100621969 (PSMB1)
Peptidases and inhibitors [BR:ssc01002]
 Threonine peptidases
  Family T1: proteasome family
   100621969 (PSMB1)
Proteasome [BR:ssc03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    100621969 (PSMB1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1
Other DBs
NCBI-GeneID: 100621969
NCBI-ProteinID: NP_001231282
Ensembl: ENSSSCG00000027257
UniProt: A0A287BPP9 A0A4X1VSI6
Position
1
AA seq 241 aa
MLSSVAAYSVPGRDLAMDPHSAAGPSQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEG
FSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAML
STILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQ
VGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGVREETVPLRK
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttgtcttcggtagcagcgtactctgtccccggcagagacttggccatggatcctcat
agcgccgcgggtccttcgcagctgcgcttttcgccctacgctttcaatggaggaactgta
ttggcaattgcgggagaagatttttcgattgttgcttctgacacccgattgagtgaaggg
ttttcaattcacacacgggacagccccaaatgttacaaattaacagacaaaacagtcatt
ggttgtagtggttttcatggagactgtcttaccctgacaaaaattattgaagcaagacta
aagatgtataagcattccaataataaggccatgactacgggggcaattgcagcaatgctg
tccacaatcctctactccaggcgcttctttccctactacgtgtacaacatcatcggggga
ctcgatgaggaagggaagggagccgtgtacagctttgaccctgtggggtcctaccagaga
gattccttcaaggctggaggctcagccagtgccatgctgcagcccctgcttgacaaccag
gttggttttaagaacatgcaaaatgtggagcatgtcccattgtccttggacagagccatg
cggctcgtgaaagatgtcttcatttctgctgctgagagggacgtgtacactggggacgca
cttaggatctgcatcgtgaccaaggagggtgtccgggaggagaccgttcctctgcggaag
gactga

DBGET integrated database retrieval system