KEGG   Sus scrofa (pig): 100622671
Entry
100622671         CDS       T01009                                 

Gene name
BANF1
Definition
(RefSeq) barrier-to-autointegration factor
  KO
K21870  barrier-to-autointegration factor
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100622671 (BANF1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    100622671 (BANF1)
SSDB
Motif
Pfam: BAF IMS_HHH
Other DBs
NCBI-GeneID: 100622671
NCBI-ProteinID: XP_003122558
Ensembl: ENSSSCG00000012961 ENSSSCG00000027377
UniProt: A0A4X1UGA0 F1RU33
Position
2
AA seq 89 aa
MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
EWLKDTCGANAKQSRDCFGCLREWCDAFL
NT seq 270 nt   +upstreamnt  +downstreamnt
atgacaacttcccaaaagcaccgagatttcgtggcagagcccatgggggaaaagccagtg
ggaagcctggccgggattggtgacgtactgggcaagaagctggaggaaaggggctttgac
aaggcctatgtggtccttggccagtttctggtgctcaagaaagatgaagacctcttccgg
gaatggctgaaggacacgtgtggcgccaatgccaagcagtcgcgggactgcttcgggtgc
ctccgggagtggtgtgatgccttcttgtga

DBGET integrated database retrieval system