KEGG   Sus scrofa (pig): 100622921
Entry
100622921         CDS       T01009                                 

Gene name
MYO1C
Definition
(RefSeq) unconventional myosin-Ic isoform X6
  KO
K10356  myosin I
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100622921 (MYO1C)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100622921 (MYO1C)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100622921 (MYO1C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100622921 (MYO1C)
   04147 Exosome [BR:ssc04147]
    100622921 (MYO1C)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100622921 (MYO1C)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Phagocytosis
   Others
    100622921 (MYO1C)
 Others
  Actin-binding proteins
   Myosins
    100622921 (MYO1C)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    100622921 (MYO1C)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100622921 (MYO1C)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100622921 (MYO1C)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 IQ AAA_22 AAA_16
Other DBs
NCBI-GeneID: 100622921
NCBI-ProteinID: XP_005657073
Ensembl: ENSSSCG00000021821
UniProt: A0A5G2QUQ1
Position
12
AA seq 1028 aa
MESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENLIYTYIGPVLVSVNPYRDLQI
YSRQHMERYRGVSFYEVPPHLFAVADTVYRALRTERRDQAVMISGESGAGKTEATKRLLQ
FYAETCPAPERGGAVRDRLLQSNPVLEAFGNARTLRNDNSSRFGKYMDVQFDFKGAPVGG
HILSYLLEKSRVVHQNHGERNFHVFYQLLEGGEEETLRRLGLERNPQSYLYLVKGQCAKV
SSINDKNDWKVVRKALTVIDFTEDEVEDLLSIVASVLHLGNLHFAANEESNAQVTTENQL
KYLTRLLGVEGSTLREALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVYSRTFTWLVA
KINRSLASKDAESPSWRSTTVLGLLDIYGFEVFQHNSFEQFCINYCNEKLQQLFIELTLK
SEQEEYEAEGIAWEPVQYFNNKIICDLVEEKFKGIISILDEECLRPGEATDLTFLEKLED
TVKHHPHFLTHKLADQRTRKSLGRGEFRLLHYAGEVTYSVTGFLDKNNDLLFRNLKETMC
SSENPIMSQCFDRSELSDKKRPETVATQFKMSLLQLVEILKSKEPAYVRCIKPNDAKQPG
RFDEVLIRHQVKYLGLMENLRVRRAGFAYRRKYEAFLQRYKSLCPETWPTWAGRPQDGVA
VLIRHLGYKPEEYKMGRTKIFIRFPKTLFATEDALEVRRQSLATKIQAAWRGFHWRQKFL
RVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHEPRCPQNAFFLDHVRTS
FLLNLRRQLPRNILDPSWPTPPPALREASELLRELCRKNMVWKYCRSISPEWKQQLQQKA
VASEIFKGKKDNYPQSVPRLFISTRLGADEISPKVLQALGSEPIQYAVPVVKYDRKGYKP
RSRQLLLTPNAVVIVEDAKVKQRIDYANLTGISVSSLSDSLFVLHVQREDNKQKGDVVLQ
SDHVIETLTKTALSADRVSNININQGSITFAGGPGRDGIIDFTPGSELLITKAKNGHLAV
VAPRLNSR
NT seq 3087 nt   +upstreamnt  +downstreamnt
atggagagcgcactgaccgcccgagaccgggtgggggtacaggatttcgtgctgctggag
aacttcaccagcgaggccgccttcatcgagaacctgcggcgacgcttcagggagaacctc
atctatacctacattggccccgtcctggtctctgtcaacccctaccgggacctgcagatc
tacagccggcagcacatggagcgttaccggggtgtcagcttctatgaggtgcccccccac
ctgttcgcggtggccgacactgtgtaccgggcattgcgcacggagcgtcgggaccaggcg
gtgatgatctctggggaaagcggggcaggcaagacagaggccaccaagcggctgctgcag
ttctatgctgagacctgcccagcccccgagcggggcggtgccgtgcgtgaccggctgctg
cagagcaacccggtgctggaggccttcggaaatgccaggaccctccggaatgacaactcc
agcaggttcgggaagtacatggacgtgcagtttgacttcaagggtgcccccgtgggtggc
cacatcctcagttacctcctggagaagtcacgggtggtgcaccagaatcacggggagagg
aacttccacgtcttctaccagctgctggaggggggcgaggaggagacgctgcgcaggctg
ggcctggaacggaacccccagagctacctgtacctggtgaagggccagtgtgccaaagtc
tcctccatcaacgacaagaatgattggaaggtcgtcaggaaggctctgacagtgatcgac
ttcacggaggatgaagtggaggatcttctgagcatcgtggccagcgtcctgcatctgggc
aacctccactttgctgccaatgaggagagtaatgcccaggtcaccaccgagaaccagctc
aagtatctgaccaggctcctgggtgtggagggctcgacgttgcgggaagcgctgacgcac
aggaagatcatcgccaagggcgaagagctcctgagcccgctgaacctagaacaggctgcg
tatgcgcgagatgcccttgccaaggccgtgtacagtcgcaccttcacgtggctggttgcc
aagatcaacaggtcactggcctccaaggacgccgagagcccgagctggcggagcactacg
gtccttgggctcctggacatttacggcttcgaagtgtttcagcacaacagctttgagcag
ttctgcatcaattactgcaacgagaagctgcagcagcttttcatcgagctcaccctcaag
tcggagcaagaggagtatgaggcagagggcatcgcgtgggagcctgtccagtatttcaac
aacaagatcatctgtgacctggtggaggagaagttcaagggcatcatctccatcctggac
gaggagtgtctgcgccccggggaggccacagacttgaccttcctggagaagctggaggac
acagtcaaacaccatccacacttcctgacgcacaagctggctgaccagcggaccaggaaa
tctctgggccggggggagttccgccttctgcactacgctggggaggtgacctacagtgtg
accgggtttctggataaaaacaatgaccttctcttccggaacctgaaggagaccatgtgc
agctcagagaatcccatcatgagccagtgcttcgaccggagcgagctcagtgacaagaag
cggccagagacggtggccactcagttcaagatgagcctcctgcagctggtggagatcctc
aagtctaaggagcctgcctatgtccgctgcatcaagcccaatgacgccaagcagcctggc
cgctttgacgaagtgctgatcaggcaccaggtgaagtacctggggctgatggagaacctg
cgcgtgcgcagagccggctttgcctatcgtcgcaaatacgaggctttcctgcagaggtac
aagtcactgtgcccagagacatggcctacatgggcaggaaggccccaggatggggtggct
gtgctgatcaggcaccttggctacaagccggaagagtacaagatgggcaggaccaagatc
ttcatccgcttccccaagaccctgtttgccacagaggatgccttggaggtccggcggcag
agcctggccacgaagatccaggccgcctggaggggctttcactggcggcagaaattcctc
cgagtgaagcgatcagctatatgcatccagtcgtggtggcgaggaacgctgggccggagg
aaggcagccaagaggaagtgggcggcacagaccatccggcggctcatccgtggcttcatc
ctgcgccacgaaccccgttgcccccagaacgccttcttcctggatcacgtgcgcacctct
tttttgctcaacctgcggaggcagctgccccggaatatcctggacccttcctggcccacg
cccccacctgccctgcgtgaggcctcggagctcctgcgggagctctgccggaagaacatg
gtgtggaagtactgccggagcatcagccccgagtggaagcagcagctgcagcaaaaagcc
gtggctagtgagatcttcaaaggcaagaaagacaattacccccagagtgtccccaggctc
ttcatcagcacacggcttggtgcggatgagatcagccccaaggtgctgcaggccctgggc
tctgagcccatccagtatgccgtgcccgttgtgaaatatgaccgcaaaggctacaagcca
cgctcccggcagctgctgctgacacccaacgccgtggtcatcgtggaggatgccaaagtc
aagcagaggattgattatgccaacctgaccggaatatctgtcagcagcctgagtgacagc
ctctttgtgctgcacgtgcagcgtgaggacaataagcagaagggggacgtggtgctgcag
agcgaccacgtgattgagacgctgaccaagacggccctcagcgccgaccgcgtgagcaac
atcaacatcaaccagggcagcatcacgttcgcagggggcccgggcagggatggcatcatc
gacttcacacccggctcggagctgctcatcaccaaggccaagaacgggcacctggccgtg
gtggccccacggctgaactctcggtga

DBGET integrated database retrieval system