KEGG   Sus scrofa (pig): 100622956
Entry
100622956         CDS       T01009                                 

Gene name
FOXL2
Definition
(RefSeq) forkhead box protein L2
  KO
K09405  forkhead box protein L
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100622956 (FOXL2)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100622956 (FOXL2)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 100622956
NCBI-ProteinID: NP_001231594
Ensembl: ENSSSCG00000028562
UniProt: Q6VFT6 A0A480Z083
Position
13
AA seq 377 aa
MMASYPEPEDAAGALLAPETGRTAKEPEAPPPLSPGKGGGGGASTAPEKPDPAQKPPYSY
VALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREG
GGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVA
GAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSP
GAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPHPHSHPHAHHL
HAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTNAPGLQFACARQPELAMMHCS
YWDHDSKTGALHSRLDL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgatggccagctaccccgagcccgaggacgccgcgggggccctgctggccccggagacc
ggccgcaccgccaaggagcccgaggcgccgccgccgctgagcccaggaaagggcggcggc
ggcggcgccagcacagccccggagaagcccgacccggcgcagaagcccccatactcgtac
gtggcgctcatcgccatggcgatccgcgagagcgcggagaagaggctcacgctgtccggc
atctaccagtatattatcgccaagtttccgttctacgagaagaacaagaagggctggcag
aatagcattcgccacaacctcagcctcaacgagtgcttcatcaaggtgccgcgggagggc
ggcggcgagcgcaagggcaactactggacgctggacccggcctgcgaggacatgttcgag
aagggcaactaccggcgtcgccgccgcatgaagcggcctttccggccgccaccggcgcac
ttccaacccggcaagggactctttggggccggaggtgccgcgggcggctgcggcgtggcg
ggtgcgggggccgacggctatggctacctggcgccccccaagtacctgcagtccggcttc
ctcaacaactcgtggccactaccgcagccgccctcacccatgccctacgcctcctgccag
atggcggcggccgcagcggccgcggcagcagcggcggcggccgcgggccccggcagcccc
ggcgcggctgcggtggtcaaggggctggctggccccgccgcctcgtacgggccatactca
cgcgtgcagagcatggcgctgcctccgggtgtagtgaactcatacaacggcttgggaggc
ccgcccgccgcgcccccgccgccgccgcacccccactcacacccgcacgcacaccatctg
cacgccgccgctgcacccccgccggcgccgccacaccacggggctgccgcaccacctccg
ggccagctcagccccgccagcccggctaccgccgcgcccccggcgcccgcgcccaccaac
gcgcccggcctgcagttcgcctgcgccaggcagcccgagctcgccatgatgcattgctct
tactgggaccacgacagcaagaccggcgcgctgcattcgcgcctcgatctctga

DBGET integrated database retrieval system