KEGG   Sus scrofa (pig): 100624169
Entry
100624169         CDS       T01009                                 

Gene name
ALKBH3
Definition
(RefSeq) alpha-ketoglutarate-dependent dioxygenase alkB homolog 3
  KO
K10860  mRNA N1-methyladenine demethylase [EC:1.14.11.54]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100624169 (ALKBH3)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.54  mRNA N1-methyladenine demethylase
     100624169 (ALKBH3)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    100624169 (ALKBH3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 100624169
NCBI-ProteinID: XP_003353938
Ensembl: ENSSSCG00000025731
UniProt: A0A480SMH5
Position
2
AA seq 285 aa
MEDKRRRARVQGAWAGPAKSQAIAQPATTTENRLPQRPGQTWMNKEHLSDRQFVFKEPQE
VVRRAPEPRVIDKEGVYEISLSPTGISRVCLYPGFVDLKEADWVLEQLCRDVPWKQRTGI
REDVTYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLLTLKNQIEQNTGHTFNSLLCNLY
RNEKDSVDWHSDDEPSLGRCPIIASLSFGATRMFEMRKKPPPEENGDYTYVDRVKIPLDH
GTLLIMEGATQADWQHRVPKEYHSREPRINLTFRTVYPDPQGARW
NT seq 858 nt   +upstreamnt  +downstreamnt
atggaggacaaaagacggcgagctcgagtgcagggagcctgggctggtcctgctaagagc
caggccattgctcagccagctaccactactgagaaccgtctcccacagagacctggtcag
acctggatgaacaaggagcatctgtctgacagacagtttgtgttcaaagaaccccaggag
gtggtacgaagagccccagagccaagagtgatcgataaagaaggtgtgtatgaaatcagc
ctgtcacccacaggcatatctagggtgtgtttgtatcctggctttgttgacttaaaagaa
gccgactgggtattggaacagctttgtcgggatgttccctggaaacagaggaccggcatc
agagaggatgtaacttaccagcaaccaagacttacagcatggtatggagaacttccttac
acttactcaagaatcactatggaaccaaatcctcactggcatcctgtgttgctcacacta
aagaaccaaatcgagcagaacactggccacaccttcaactccttgctctgcaatctttac
cgaaatgagaaggacagcgtggactggcatagtgatgacgagccctcgctggggaggtgc
cccatcattgcttcactcagttttggtgccactcgcatgtttgagatgagaaagaagccc
ccaccagaagagaatggagactacacatatgtggacagagtgaagatacccttggatcac
gggaccttgttaatcatggaaggagccacacaagcagactggcagcatcgagtgcccaaa
gagtaccactctagagagccaagaataaacctgacctttcggacagtttatcctgacccc
caaggggcgcgctggtga

DBGET integrated database retrieval system