KEGG   Sus scrofa (pig): 100624677Help
Entry
100624677         CDS       T01009                                 

Gene name
HNMT
Definition
(RefSeq) histamine N-methyltransferase
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00340  Histidine metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100624677 (HNMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100624677 (HNMT)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     100624677 (HNMT)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100624677 (HNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_16 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 100624677
NCBI-ProteinID: NP_001231490
Ensembl: ENSSSCG00000024023
UniProt: A0A287AA45 A0A4X1SYB7
Position
15
AA seq 292 aa AA seqDB search
MASSMRSLFSDHGRYVESFRRFLNNSTEHQCMQEFMDKQLPGIIASIGDTNSEIKILSIG
GGAGEIDLQILSKVRAQYPGIRINNEVVEPSAEQITKYKELVAKTSNLENIKFAWHKETS
SEYQNRMMQKKELQKWDFIHMIQMLYYVEDIPATLKFFHSLLASHAKILIILVSGASGWD
KLWKKYGSRLPRDDLCQYVTSSDLTQMLDKLGIKYECYDLLSTMDISDCFIDGNENGDLL
WDFLTETCHFNATAPPDLKEEIMKDLQEPEFSVKKGGKVLFNNSLSFIVVWG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccatgaggagcttgttttctgaccacggcagatatgttgaatcttttcgg
aggtttctcaacaattccacggaacaccagtgcatgcaggaattcatggacaagcagcta
ccaggcataatagcaagcattggagacacaaattctgaaattaagattctaagcattggt
ggaggtgcaggtgaaattgatcttcaaattctctccaaagtacgggctcaatacccagga
attcgtatcaacaatgaagttgttgaaccaagtgctgaacaaataaccaagtacaaagag
cttgtagccaagacatcaaacctcgagaacataaagtttgcctggcataaggagacatca
tctgaatatcaaaatagaatgatgcagaaaaaagaacttcagaagtgggactttattcat
atgattcagatgctgtattatgtagaagatattccagccaccctcaagttcttccatagc
ctcttagctagtcatgctaagattctcattattcttgtgtcaggagccagtggctgggac
aagctatggaaaaagtatggatctcgcttaccccgggatgacctctgccagtatgtcaca
tcgtctgacctcactcagatgctggacaagttggggattaagtatgagtgttatgacctt
ctatccaccatggacatatctgactgttttattgatggcaatgaaaatggagacctgctc
tgggattttttgacagaaacctgccactttaatgcaacagcaccacctgatctcaaagaa
gaaattatgaaggatctgcaggaacctgaattcagtgtaaagaaagggggaaaggttctt
tttaataatagtctgagtttcatagtagtttggggataa

DBGET integrated database retrieval system