KEGG   Sus scrofa (pig): 100624847
Entry
100624847         CDS       T01009                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100624847 (AHRR)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100624847 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3
Other DBs
NCBI-GeneID: 100624847
NCBI-ProteinID: XP_020932726
Position
16
AA seq 699 aa
MIPPGDCMYAGRKRRKPVQKQRPAVGAERSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERCPRQPAAGAPSAGDRGPHRGSAVLEGRLLLESLH
GFALVVSAEGLIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
LCGQPLLSGSGEDAVLGRLLQAQEGAAGLPPEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLRFLFGQKRKAPSGAALPPRLSLFCVAVPVLLPPVAEVSGKSAYLRAKHRVDISATP
DAGAKATPSLCGSDLHGKPSYVAGRSNGENGLSVFRAPTDACRWGRVPARAPCLCFRGDS
DLVLDPEGATGFSSCRDGGGEEPRGVRRDVPPHSCRLETPGSTKHLSWTPGKHGQDGSTK
LKLDPSNSDLFSVLALPRGACLPCPGLQGTDHAGGAVASRNPASGHLPRHPPCACAGRTS
RAVRGGHQGQVHPPPSCPFPQGGLGGGLPQRLPAGGYPAQDKFHGLPMLPGALRNPVSSL
DVPIKMERDSGAEDTADGYSVSPSQVWVGASDVAKSQLVTFPTRMHLKTEPDARHPLYSP
HLRHGGLLGAHPRPGREPAPFQPAPCACLEPPPRLARGHQPPTGDCDCRAPGSAPVVKLE
PLDLPPWAAHSQGGAPGMFPKSALATRMPARDPECVFLP
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgattccgccgggggactgcatgtacgccgggaggaaaaggaggaagcccgtccagaag
cagagacccgccgtgggggctgagaggtcgaacccttccaagaggcaccgggaccgcctc
aacgcggagctggaccacctggccagcctgctgccgctgccacctgacatcatctctaag
ctggacaagctttcagtcctgcgtctcagcgtcagttacctcagggtgaagagcttcttc
caagccctgcaggagcggtgcccgcggcagccggcggcaggtgccccctcggcgggagac
agaggtccgcacagagggtccgcggtgctggaggggaggctgctgctggagtctctgcat
ggctttgccctggtcgtgagtgccgaaggcctgatcttctacgcgtcggcgacgatcgtg
gattacctgggcttccaccagacggacgtgatgcatcagaacatctacgactacatccac
gtggacgaccgacaggacttctgccggcagctccactgggccatggaccccccgcaggcg
ctctgcgggcagcccctgctctcagggtccggcgaggatgccgtcctggggaggctgctc
caggctcaggagggggctgcgggcttgccccccgagtactcggccttcctgacgcgttgc
ttcatctgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaagctacgattcctgtttggacagaagaggaaggcaccgtcgggggcggcctta
cccccccggctctccctgttctgcgtcgcggtgccggttctcctgcctcctgtggcggaa
gtgagcgggaagagtgcctatcttcgggctaagcaccgcgtggacatctcggccacaccg
gatgcgggagcaaaagccactccaagtctgtgtgggtcagacttgcacggaaaacccagt
tacgtagcaggaaggagcaatggagaaaacggcctttctgtgttcagggcaccgacagat
gcctgccgctggggccgggttccagccagagcgccctgcctgtgcttccggggtgactct
gacctcgtccttgaccctgagggggccacaggcttctcttcctgcagggatgggggagga
gaggagcccagaggggtgcggagggacgtgccccctcacagctgtcgcctggagacgccg
ggatccacgaagcacctgagctggaccccagggaaacatggtcaggatggcagcaccaag
ctgaagctggaccccagcaacagcgacctgttctctgtgcttgctctgccccgtggcgcc
tgcctgccctgccctggcctacagggcaccgaccatgccggcggtgccgtggcctccagg
aacccagccagcggtcacctgccaaggcaccccccctgcgcctgcgccggccggaccagc
agagccgttcggggcggccaccagggccaggtgcaccctccccccagctgccccttccct
caggggggcctgggcggggggctcccgcagcgtctcccagcggggggctatcctgcccag
gacaagtttcacggactcccgatgctcccaggagccctgaggaaccccgtgtcctcactc
gacgtacccatcaagatggagcgtgactctggggccgaggacacagcagatggctactct
gtgtccccaagccaggtgtgggtgggggccagcgatgtggccaagagccagctggtcact
ttcccgaccaggatgcacctgaaaacagagccagacgccaggcaccccctgtacagcccg
cacctgcggcacggcggcctgctgggggcccaccccagacccggcagggagccagccccc
ttccagcccgcaccctgcgcctgcctggagcctccgccccgcctcgcgcgaggccaccag
cccccgactggggactgcgactgcagagctcccgggtccgcgccggtggtcaagctcgag
cccctggacttgcccccgtgggctgctcacagccagggcggtgcgcccgggatgttcccc
aaaagtgccttggcgacgcggatgccggcccgcgaccccgagtgcgtgttcctgccgtag

DBGET integrated database retrieval system