KEGG   Sus scrofa (pig): 100624857Help
Entry
100624857         CDS       T01009                                 

Gene name
DRD2
Definition
(RefSeq) D(2) dopamine receptor
  KO
K04145  dopamine receptor D2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04015  Rap1 signaling pathway
ssc04024  cAMP signaling pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04540  Gap junction
ssc04728  Dopaminergic synapse
ssc05012  Parkinson disease
ssc05030  Cocaine addiction
ssc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100624857 (DRD2)
   04024 cAMP signaling pathway
    100624857 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100624857 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100624857 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100624857 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100624857 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    100624857 (DRD2)
   05034 Alcoholism
    100624857 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100624857 (DRD2)
G protein-coupled receptors [BR:ssc04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    100624857 (DRD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 RIFIN DUF2207 Stevor
Motif
Other DBs
NCBI-GeneID: 100624857
NCBI-ProteinID: NP_001231182
Ensembl: ENSSSCG00000015048
UniProt: A0A4X1T900 F1SM69 A0A287B0Q7
Position
9
AA seq 443 aa AA seqDB search
MDPLNLSWYDDDLESRNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHALHSTPDSPARPEKNGHAKDHPKIAKIFEIQSMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggatccactgaacctgtcctggtacgatgacgatctggagagccggaactggagccgg
cccttcaacgggtccgaagggaaggccgacaggccccactacaactactatgccatgctg
ctcaccctgctcatcttcatcatcgtcttcggcaacgtgctggtgtgcatggccgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgccgtggccgac
ctcctggtggccacgctcgtcatgccctgggtggtctacctggaggtggtgggcgagtgg
aaattcagcaggattcactgtgacatctttgtcactctggacgtcatgatgtgtacagcg
agcatcctgaacctgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctctacaacacacgctacagctccaagcgccgagtcaccgtcatgatcgccatcgtctgg
gtcctgtctttcaccatctcctgcccgctgctttttggactcaacaacacagaccagaac
gagtgcatcatcgccaaccccgcgttcgtggtctactcctccatcgtctccttctacgtg
cccttcatcgtcaccctgctggtctacatcaagatctacatcgttctccgcaggcggcgc
aagcgggtcaacaccaagcgcagcagccgggctttcagggccaacctgaaggccccactc
aagggcaactgcacgcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccgccgagcccaggaactggag
atggagatgctctccagcaccagtccacccgagaggacccggtacagccccatcccgccc
agccaccaccagctgaccctccccgacccgtcccaccatgccctccacagcacacctgac
agccctgccagaccagagaagaacggacacgccaaagatcaccccaagattgccaagatc
tttgagatccagtccatgcccaatggcaaaacccggacctccctcaagaccatgagccgc
aggaagctctcccagcagaaggagaagaaagccacccagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacccacatcctgaacatacactgtgac
tgcaacatcccgcccgtcctgtacagcgccttcacgtggctgggctacgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacatcgagttccgcaaggccttcctgaagatc
ctacactgctga

DBGET integrated database retrieval system