KEGG   Sus scrofa (pig): 100624923
Entry
100624923         CDS       T01009                                 

Gene name
SNX13
Definition
(RefSeq) sorting nexin-13 isoform X2
  KO
K17925  sorting nexin-13
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100624923 (SNX13)
SSDB
Motif
Pfam: PXA Nexin_C PX RGS Swi3
Other DBs
NCBI-GeneID: 100624923
NCBI-ProteinID: XP_003357507
UniProt: I3LUU8 A0A4X1TF12
Position
9
AA seq 1153 aa
MREGSFSTGHLPPCPRDAGGSQRHQCKSRPPPVLLHPRVSRPRRAAEEERPPQACTPAPR
WTQRWGVSELPSVPGRPVSPAAEPLKQAPSGSPAIRLRLLARRRYGDSHETPAAPAPANG
SARRGETRTSLFQDGGASVASSRAGGKPAKPSKAAARERTEGAVAAVGGGLGSFRCCYGC
CHAARLGRSSLPRGVIMLTETSLSIWGWGSLGIVLSLITFGPFVIFYLAFYILCFVGGGF
VVTLLFGKTNSEKYLEQCEHSFLPPTSTGIPKCLEEMKREARTIKIDRRLTGANIIDEPL
QQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDD
FGTHLRVFRKAQQKITEKDDQVKGTAEDLIDTFFEVEVEMEKDVCRDLVCTSPKDEEGFL
RDLCEVLLYLLLPPGDFQNKTMRYFVREIIARGILLPLINQLSDPDYINQYIIWMIRDSN
CNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVC
DSRIQRLQSGKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWM
TVEGYRVTAQQQLEVLSSRQKDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYL
VAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSF
RGSDDGDGESFNGSPTGSINLSLDDLSNVSSDDSVQLHAYISDTGVCNDHGKTYALYAIT
VHRRNLNSEEMWKTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKK
DLNAYLQLLLTPEMMKASPALAHYVCDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVS
NAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIRQSFFKVPPLIPKTDSDPEHCRVSAQLD
DTVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWM
TSPEQVADLVKRFRDAFWPNGILAESVPCRDKAIRMRTRVAGKTKLLSIMPDELKHIIGA
ETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQ
KLQTTQAPSLQKR
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcgagagggaagtttttctactggacatctgccgccttgtccccgagacgcgggaggt
tcacagcgccatcagtgcaagtctcggccgccgccggtcttgctccaccccagggtcagc
cgaccccggcgtgcggcggaggaagagcggccgccgcaggcatgcacgcctgctcccagg
tggacccagcgctggggcgtttctgaactcccctcggtccccggtcggccagtgagccca
gcggcggaacccttgaagcaggcgcctagtggatctccggccatccgcctccgcctcctc
gcgcgccggcgctatggcgacagtcacgagacgccagctgccccggcgcccgccaatggg
agcgcacgtcgcggggagacgcggacgtcgctcttccaagatggcggcgcgtccgtcgcg
agcagccgggccggggggaagccagcgaagccgagtaaagccgccgcccgggagaggact
gaaggagctgtcgccgccgttggcggcggcttgggcagttttcgctgctgctacggctgt
tgccatgcggcgaggctagggaggagctcacttccccggggtgtaataatgttaacagag
acaagtctatccatatggggatggggaagccttggcattgtcctctctctgataacattt
ggaccctttgtaatattttatttggcattttatatcctctgctttgtgggtgggggtttt
gtggttactctcctgtttgggaaaaccaactcagagaagtacctagaacagtgtgaacac
tcatttcttcctccaacatcaacagggattcctaagtgcttagaagaaatgaaacgggaa
gccaggactataaagattgatagaagattgacaggtgccaatattattgatgagcctctc
cagcaagttatccagttttccttaagggattatgtccaatattggtattatacattaagt
gacgatgaatcttttcttcttgaaattaggcagactcttcaaaatgcactcattcagttt
gctactaggtcaaaagaaatagactggcaaccttattttactacacgcatcgtagatgat
tttggcacacacctaagagtattcagaaaggctcaacagaagataacagagaaagatgat
caagtgaaaggtacagcagaagatcttatagataccttctttgaagttgaagtagaaatg
gagaaggacgtttgccgtgatctagtgtgcacctctcccaaagatgaagaaggattccta
agggatttatgtgaggtcttattatatttattgctacctcctggagattttcagaacaag
accatgcgatactttgtcagggaaatcattgcacgaggaattcttcttccattaataaat
caactcagtgatcctgattatattaatcaatatatcatatggatgatccgtgattctaat
tgcaattatgaggcctttatgaacattattaaattgagtgacaatattggagagctagaa
gcagtcagagataaagcagcagaagaattacagtatctccgatctctagatacagctggt
gatgatatcaacactatcaaaaatcaaatcaatagcttattatttgtaaaaaaagtatgt
gactcaagaatacaacggttgcagtcaggcaaagaaataaatactgtgaaacttgcagca
aactttgggaaactttgcacagtccccctggacagcattcttgtagacaatgttgcacta
caattttttatggattacatgcagcaaactggaggtcaagcacatctcttcttctggatg
acagtggaagggtaccgcgttacagcccaacagcagctggaagttttatcaagtcggcag
aaagatggaaaacatcaaaccaaccaaaccaaaggtcttttaagagcagctgctgttgga
atttatgaacaatatttatcagaaaaggcgtctccaagggttactgttgatgactatttg
gtagcaaaactagcagatactttgaatcatgaagatccaactcctgaaatctttgatgac
attcaaaggaaggtatatgaattgatgctacgagacgaaagattttatccttccttcaga
cagaatgcactttatgtgcgtatgttagctgagctggatatgttaaaagatcctagtttc
agaggatcagatgatggggatggagaatcttttaatgggtctcctacaggaagcataaat
ttgtctttagatgacctttcaaatgtatcttctgatgactcagtacaacttcatgcttac
atttcagacactggcgtttgtaatgatcatggcaagacgtatgcattatatgccatcact
gtacaccggcgcaatctaaacagtgaggagatgtggaaaacctaccgtcgttatagtgac
ttccatgacttccacatgaggatcactgaacagtttgaaaatctatcaagcatattaaag
cttcctggtaaaaagacttttaataatatggatagagattttttagaaaagagaaaaaag
gatctaaatgcatatttgcagttactgttaactcctgagatgatgaaagcatctccagct
ttggctcactatgtgtgtgattttcttgagaacaaagcctacagtaaagggaaaggggat
tttgctcgcaagatggacacttttgtaaatccacttcgaaattctatgaggaatgtttca
aatgcagttaaatcccttcctgatagcttggcagagggaatgactaaaatgtcagacaac
atgggcaaaatgtcagaaagattaggtcaagacataaggcaatcatttttcaaggtgcct
cctttaattccgaagactgattcagatcctgaacattgtcgagtttcagctcaacttgat
gatactgtggatgacaatattccacttagggtaatgctgcttctcatggatgaagtattc
gacttaaaagagagaaatcagtggttgcgaaggaatatcaaaaatctacttcaacaactt
attagagccacatatggtgatactattaataggaaaatagttgaccatgttgattggatg
acctcacctgagcaagtagccgacttagtgaaacgtttcagagatgccttttggccaaat
ggcattttagcagagtctgttccatgcagagataaagctattcgaatgagaacaagagtt
gcaggaaaaactaagttactttccattatgccagatgaactgaagcacattattggggct
gagaccacacgaaagggtattcttcgtgtttttgaaatgtttcaacacaaccagttaaac
aggagaatggtttatgtctttttggaaggctttttggaaaccttatttccacagtataaa
ttccgtgaacttttcaacaaactgcattcacggtcaaagcagatgcagaaatataaacag
aaacttcagactactcaagcgccttctttacagaaaaggtga

DBGET integrated database retrieval system