KEGG   Sus scrofa (pig): 100625006
Entry
100625006         CDS       T01009                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100625006 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100625006 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 100625006
NCBI-ProteinID: XP_003360494
Ensembl: ENSSSCG00000030843
Vega: OTTSUSG00000004859
UniProt: A0A5G2R3Z5 A0A4X1W9W6
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLSAVCGGPLLQTSGGKGMEEGNVRYLVQPRGPRSGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatcttcggctctgcgtgcaggcgctcctgctgctctggctctccctgagcgcggtg
tgtggagggcccctgctgcagacctctggcgggaaggggatggaggaaggcaacgtccgc
tatttggtgcagcccagagggccgaggagcggcccaggaccctggcagggaggtcggagg
aagttccggcgccagcggccacgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system