KEGG   Sus scrofa (pig): 100625586
Entry
100625586         CDS       T01009                                 

Gene name
OGFOD1
Definition
(RefSeq) prolyl 3-hydroxylase OGFOD1
  KO
K24029  prolyl 3-hydroxylase /prolyl 3,4-dihydroxylase [EC:1.14.11.-]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100625586 (OGFOD1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     100625586 (OGFOD1)
SSDB
Motif
Pfam: Ofd1_CTDD 2OG-FeII_Oxy_4 2OG-FeII_Oxy_3
Other DBs
NCBI-GeneID: 100625586
NCBI-ProteinID: NP_001231248
Ensembl: ENSSSCG00000025953
UniProt: A0A480KCY2 A0A4X1UD43
Position
6
AA seq 545 aa
MNGKRSTELGPGRAGKKVKKEVMANISDAVTEETLKKQVAEAWSRRTPFRHEAIVMDMDP
FLHCVIPNFIQSQSFLEGLQKELLNLDFHEKYNDLYKFQQSDDLKKRREPHICALRKILF
EHFRAWLSDISKIDLESTIDMSCAKYEFSDALLCHDDELEGRRIAFILYLVPPWDRSLGG
TLDMYSVDEHFQPKQIVKSLIPSWNTLVFFEVSPISFHQVSEVLSEEKSRLSISGWFHGP
SLTRPPTYFEPLLPRSPHIPQDHEVLCDWINPTYLDMEYQVQIQEEFEESSEILLKEFLK
PEKFAEVCEALEKGDVEWTSQGPPNKRFYEKAEESKLPKILKDCMALFRSEAMFLLLSNF
TGLKLHFLAPSEEDELEDKKEGEAASPADNTEEGTSHSSFEPENSREAISDSSQQSNEQI
DPEPEETKAKKESSVPTCQGELRHWKTGHYTLIHDNTKTEFALDLLLYCGCEGWEPEYGG
FTSYIAKGEDEELLTVNPENNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWNFS
FVYYE
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgaatgggaaacggtcgactgagcttggccctggtcgggcgggaaaaaaagtaaagaag
gaggtgatggcgaatatttcggatgctgtcacggaggaaaccttgaaaaagcaggtggct
gaggcctggagtcgtaggacgccgttccgtcacgaagccattgttatggacatggacccc
tttcttcactgcgtgatcccaaacttcatccaaagccaaagcttcttggaaggacttcag
aaggaacttttgaacttggacttccatgaaaagtataacgatttatataagttccaacag
tctgatgatttgaagaaaagaagagagcctcacatctgtgctttaaggaaaattctgttt
gaacatttccgggcttggctttctgacatttccaagattgatctggaatcaaccattgac
atgtcttgtgctaaatatgaattttcagatgctctgctctgccatgatgacgagctggaa
gggcgccggatcgccttcattctttacctggttcctccctgggacaggagcctggggggc
accttggacatgtacagtgttgatgagcactttcagccgaagcagattgtcaagtccctt
atcccatcatggaacacactggttttcttcgaagtatctccaatatcctttcaccaggtg
tctgaagtcctgtctgaagagaagtctcgtttgtctatcagtggctggtttcatggtcct
tcgctgaccaggcctcccacctactttgaacctctcctacctcggagccctcacatccca
caagatcatgaagttttgtgtgactggatcaaccctacttatcttgacatggaataccaa
gttcaaatacaagaagaatttgaagaaagctccgaaattctcctaaaagagttccttaag
cctgagaaatttgcagaggtgtgtgaggctttggagaaaggagatgtggaatggaccagc
caaggtccccctaacaaaaggttttacgagaaggctgaggagagcaagcttcccaaaatc
ctgaaggactgcatggcattatttcgctcagaggcaatgttcttgctgctctccaacttc
acaggcctgaaacttcacttcttggctccttcagaagaagatgagcttgaagacaaaaaa
gagggagaagcagcctctcctgctgataacactgaagaagggactagccacagctccttt
gagccagagaacagtcgggaggccattagcgacagcagccaacagagcaatgaacagata
gacccagagccagaggaaaccaaagcaaagaaagaatcaagtgttcccacatgccagggg
gaactgaggcattggaagactggtcactacactttaatccatgacaacaccaagactgaa
tttgccctggacctcctcctctactgcggctgtgaaggatgggagccagaatatggtggc
tttacctcctacattgccaaaggtgaagacgaagagctactgacagtgaatccagaaaac
aattctttggccttggtctacagagacagagaaactctgaaatttgttaagcatattaac
caccgaagcctggaacaaaagaaaaccttcccaaacagaacaggtttctggaacttttca
tttgtctactacgaatga

DBGET integrated database retrieval system