KEGG   Sus scrofa (pig): 100625970Help
Entry
100625970         CDS       T01009                                 

Gene name
CALCOCO1
Definition
(RefSeq) calcium-binding and coiled-coil domain-containing protein 1 isoform X2
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: CALCOCO1 SKICH Zn-C2H2_12 Pox_A8 DUF3450 FlaC_arch
Motif
Other DBs
NCBI-GeneID: 100625970
NCBI-ProteinID: XP_005652631
Ensembl: ENSSSCG00000028481
UniProt: I3LSQ0 A0A480PHS3 A0A4X1WAF5 A0A287AYQ8
Position
5
AA seq 691 aa AA seqDB search
MEESSLSRAPSRGGVSFLNVARTYIPNTKVECHYTLPPGTVPSASDWIGIFKVEAACVRD
YHTFVWSSVPEGVTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGRVCGQSPPFQFRE
PRPMDELVTLEETDGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSR
VQELETALATARQEHAELSEQYKGLARSHGELTEERDILSRQQGDHVARILELEEDIQTI
SEKVLTKEVELDRVRDAVKALTREQEKLLGQLKEVQADKEQSEAELQMAQQENRRLNLEL
QEAKGRQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKAT
LLGEELASTAGARDRTIAELHRSRLEVAGVNGRLAELSLHLKEEKSQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEEKTQNQAFKTELAREKDSSLVQLSESKRELTELRSALR
VLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWSEDPATEDEEAAAGLSCPVALSDSE
DESPEDMRLPPYGLCERGDPDSSPAGPREASPLVVISQPAPIAPHLSGPAEDSSSDSEAE
DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFAVGPLSEAGPGGPATPPWKECPICK
ERFPAESEKDGLEHHMDGHFFFSTQDPFTFE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatcatcactaagccgggcaccatcccggggtggagtcagctttctgaacgta
gcccggacctacattcccaacaccaaggtggagtgtcactacacacttcccccaggcacc
gtgcccagtgccagcgactggattggcatcttcaaggtggaggctgcctgcgttcgggat
taccacacgtttgtgtggtcctcggtgcctgaaggtgtaactgatggttcccccatccac
accagtgtccagttccaagccagctacctgcccaaaccgggagcccagctctaccagttc
cggtatgtgaaccgccagggccgggtgtgtgggcagagcccccctttccagttccgcgag
ccccggcccatggatgaactggtgaccctggaggagactgacgggggctctgacatcctg
ctggttgtccccaaagcaactgtgctgcagaaccagctggatgaaagccagcaagagagg
aatgacctgatgcagctgaagctgcagctggaggggcaggtgacggagctgaggagccga
gtacaggagcttgagacggccctggcaaccgccaggcaggagcacgcggagctttcggag
cagtacaaggggcttgcccggtcccatggcgagctcacggaagagagggacatcctgagc
cggcaacagggagaccacgtggcccgcatcctggagctggaagaggacatccagaccatc
agtgagaaagtgctgacgaaggaggtggagctggacagggttagagacgcggtgaaggcc
ctgactcgggaacaagagaagctccttgggcagctgaaggaagtccaggcagacaaggag
caaagcgaggccgagctccagatggcacaacaggagaaccgtcgcttgaatttggagctg
caggaggccaagggccggcaggaggagcagagcgctcaggcccagagactgaaggacaag
gtggcccagatgaaggacactctgggccaggcccagcagcgggtggctgagttggagccc
ctgaaggagcagcttcgaggggcccaggagcttgcagcctcgagccagcagaaagccacc
cttcttggggaggagctggccagcacagcgggagccagggaccgcaccatagccgagctg
caccgcagccgcctggaagtggccggagtcaacggcaggctggccgagctcagtctgcac
ttgaaggaggagaagagccagtggagcaaggagcgagcggggttgctgcagagtgtggag
gcagagaaggacaagatcctgaagctgagtgcggagatactgcgactggaaaaggcagtg
caggaggagaagacccagaaccaagcgttcaagactgaactggcccgggaaaaggactct
agcctggtgcagttgtcagagagtaagcgggagctgacggagctgcggtcggccctgcgc
gtgctccagaaggagaaggagcagcttcaggaggagaagcaggaactgctggagtacatg
agaaagctggaggcccgcctggagaaggtggcagacgagaagtggagtgaggaccctgcc
acagaggacgaggaggccgctgcaggcctgagctgcccggtggctctgtcagactcggag
gacgagtctccagaagacatgaggctcccgccctatggcctgtgtgagcgtggagacccc
gactcctcccctgcggggccacgagaggcttctcccctggttgtcatcagccagccagct
cccattgctccccacctctcagggccagccgaggacagtagctctgactcggaggctgaa
gatgagaaatcagtcttgatggcagctgtgcagagtggcggtgaggaggccaacctgcta
cttccggaactgggcagtgccttctatgacatggccagtggctttgcggtgggtcccttg
tcagaggccggccctgggggccctgccacccccccgtggaaggagtgccccatttgtaag
gagcgcttcccagctgagagcgagaaggatggcctggagcaccacatggacggacacttc
ttcttcagcacccaggaccccttcaccttcgagtga

DBGET integrated database retrieval system