KEGG   Sus scrofa (pig): 100626137
Entry
100626137         CDS       T01009                                 

Symbol
DSG4
Name
(RefSeq) desmoglein-4
  KO
K07599  desmoglein 4
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ssc04515]
    100626137 (DSG4)
Cell adhesion molecules [BR:ssc04515]
 Cadherins
  Major cadherins
   100626137 (DSG4)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Cadherin_3
Other DBs
NCBI-GeneID: 100626137
NCBI-ProteinID: XP_003356443
Ensembl: ENSSSCG00000020740
UniProt: I3L5R5
Position
6:115288606..115325322
AA seq 1042 aa
MDWLLFRNICLLIILMVVLEVNSEFIVEVKELDMENGTTKWQTVRRQKREWIKFAAACRE
GEDNSKRNPIAKIRSDCEVSQKITYRISGAGIDRPPYGVFTINPRTGEINITSVVDREIT
PLFLIYCRAVNSRGEDLERPLELRVKVMDINDNPPVFTQNVYAASIEENSEANTLVVKLS
ATDADEENHLNSKIAYKIISQEPAGAPMFILNRYTGEVRTMSSFLDREQHSTYNLLVRGS
DRDGATDGLSSECDCRIKVLDVNDNFPILEKTFYSASIEENCLSSELIRFQAIDLDEEGT
DNWLAKYVILSGNDGNWFDIQTDPRTNEGILKVVKVLDYEQVPNIHLSIGVKNQAEFHHS
VASQFRMHSTPVKIQVVNVREGPAFHPNSMTFSVREGMRGNSLLNYVLGTYTAIDLDTGN
PATNVRYIIGHDAGNWLKVDSRTGEIQFSREFDKKSKYITNGIYTAEILAIDDGTGKTAT
GTICIEVPDVNDYCPVIVAERETICITSPSILISATGVTDHSYGAPFTFCVVDQPPGTAD
SWDIRSINATSAILTAEQVLYPLDYEIPILVKDSFNRACELPQIVALKACDCDSNHVCLY
LGTTGIHTGDGSSVTSVSVTDDQTGTSNVGLGPTGMGMIALGLLLLLLSPLLLLMCCCKR
KQPEGLGTRFAPVPEGGEGVIQSWRIEGAHPEDRDMSNIRAPVTVTASNTQDRIDSSEIY
TNTYAGGGTVEGGVSGVELNTGLGTAAGLVAGGAVSTARKRSSTLGTQRDYADNSLNLAF
LDSYFSEKAYAYADEDEGRPANDCLLIYDHEGAGSPVGSIGCCSWIVDDLDESYMETLDP
KFRTLAEICLNTEIEPFPSQLACIPINTDLPLLGPNYFVNESSGMNLSEAEFQAEMAAPE
PTIHGDVAVTETYTTADPCVQPTAIVFDPQLAPNIVVTETVLAPVYDVQGNICVPAELAN
THNVIYAERVLSSPGMTDISNSSMTDGCVGPTMSGGILVGPEIQVMQMVSPDIHLNQTIG
STSPMTSRHRVTQYSNIHYSQQ
NT seq 3129 nt   +upstreamnt  +downstreamnt
atggattggctccttttcaggaacatttgccttttgatcattttaatggtggtgctggaa
gtaaacagtgaatttattgttgaggtcaaagaattagacatggagaatggcaccacaaaa
tggcaaaccgtcagaagacagaagcgagagtggatcaagtttgctgcggcctgtagagaa
ggagaagataactctaagaggaatcctattgccaaaattcgatcagactgtgaagtgagt
cagaagattacataccgcatctctggggcaggaattgatcgaccaccatatggcgtattc
accattaatcctagaactggagaaattaacatcacttcagtggtggacagagagataaca
ccacttttcttgatctattgtcgggctgtaaattcaaggggtgaagatttagaaaggcct
cttgagcttagagtcaaagttatggacataaacgataaccccccagtttttacacaaaat
gtgtatgcagccagcatcgaagaaaacagtgaagcaaacaccctggtagtgaaattaagt
gccacagatgcagatgaagagaatcatctgaattctaaaattgcctataagatcatctct
caggagccggcaggtgcaccaatgttcatcctgaacaggtacaccggcgaagtgcgcaca
atgtccagtttccttgacagagagcaacacagcacgtacaacctcctcgtgaggggctca
gatcgggatggagctacagacggactgtcttccgagtgtgactgcagaatcaaggtttta
gacgtcaacgataacttccccattttggaaaaaactttttactcagccagtattgaagag
aattgtttaagttcggaactgatacgattccaagcaattgatcttgacgaagaaggcact
gacaactggttggcaaaatatgtaattctgtctggaaacgatgggaattggtttgatatt
caaactgacccacgaaccaatgaaggaattctgaaagtcgttaaggtgctggattatgaa
caagtgcctaatattcaccttagtattggagttaaaaaccaagctgaatttcaccactca
gttgcttctcagttccgaatgcactcgacccctgtgaaaattcaagttgttaatgtgaga
gaaggacccgcatttcatccaaattctatgactttcagtgtgagggaaggaatgagagga
aattccttattgaattatgtgcttggtacatacacggctatagatctggatacaggaaat
cctgcaacaaatgtcaggtatatcataggacatgatgcaggcaactggttaaaagtagat
tcaaggactggtgagatacaattttctagggaatttgataagaagtcaaaatatataacc
aatgggatatacacagcagagatcctggctatagatgatggcactgggaaaacggccaca
ggaaccatatgcatcgaagtgcctgatgtcaatgactactgtccagtcattgttgctgaa
agggaaactatctgcattacttctccttccatccttatctctgcaacaggcgttactgat
cactcttatggggctccctttaccttctgtgttgttgatcagcccccagggacagctgac
agttgggatatcagatcaataaatgctacctctgcaatcctgacagctgagcaggtttta
tatcccttagattatgaaatcccaatcctggtgaaggacagttttaacagagcatgcgaa
ttgccacagattgtggcgttaaaggcctgcgattgcgacagcaaccacgtgtgcttgtac
ctgggtaccacgggcatccacactggggacggcagctctgttaccagtgtgtctgtcact
gatgatcaaactgggacttcaaatgttggacttggacccacagggatgggcatgattgct
ctgggcctcttactactgcttttgtcaccactcttgctgctcatgtgttgctgcaaacga
aaacagccagaagggctggggacaaggtttgctcctgtgccagaggggggagaaggagtg
atacagtcctggagaatagaaggggcccatccagaggacagggacatgtcaaatatacgt
gcaccagtgacagtgacagcctctaatacccaggatcgtatagattcctctgaaatctac
actaacacctatgcaggcggaggaacggttgaagggggtgtgtcaggagtggaactcaat
acaggtcttgggacagccgctggcttagtggctggaggagccgtgagcacagccaggaag
aggagctcaacgctaggaacccagcgggactatgcagacaacagcctgaacctggccttc
ttggacagctacttctcagagaaagcatatgcttacgcagatgaagatgaaggccggcca
gcaaacgactgtttgctcatttatgaccatgagggagcagggtctcctgtgggctccatt
ggttgttgcagttggattgtggatgatttagacgaaagctacatggaaacgttagatcca
aaatttaggactcttgccgaaatctgcttaaacacagaaattgaaccatttccatcacag
ctggcgtgtatacctatcaataccgacctccctttacttggaccaaattactttgttaat
gagtcttcaggaatgaatctctcagaggctgagttccaggcagaaatggcagcacctgag
cccacaattcatggggatgttgcagtgaccgagacttacactacggccgatccatgcgtg
caacccactgcaattgtttttgatcctcagcttgcacccaacattgtagtaacggaaaca
gtattggcacctgtctatgatgttcaagggaatatttgcgtacctgctgagttagccaac
acacacaatgtaatctatgctgagagagtgctgtctagtcctggtatgactgatataagc
aatagtagcatgaccgatggttgtgtaggacccacaatgagtggcggtattttggtagga
ccagaaattcaagtgatgcaaatggtgagtccagacattcacttaaaccaaaccattggt
tccacatccccaatgacatctcgacacagagtaacacagtatagcaacatacattattcc
caacaataa

DBGET integrated database retrieval system