KEGG   Sus scrofa (pig): 100626414Help
Entry
100626414         CDS       T01009                                 

Gene name
RAB29
Definition
(RefSeq) ras-related protein Rab-7L1
  KO
K07916  Ras-related protein Rab-7L1
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ssc04031]
    100626414 (RAB29)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    100626414 (RAB29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA MMR_HSR1 ATP_bind_1 PduV-EutP AAA_16 DLIC TniB AAA_7 MMR_HSR1_Xtn
Motif
Other DBs
NCBI-GeneID: 100626414
NCBI-ProteinID: XP_003357447
Ensembl: ENSSSCG00000026269
UniProt: A0A287B978 A0A4X1UUZ3 I3LHE8
Position
9
AA seq 203 aa AA seqDB search
MSSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEVVRLQ
LWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGGPVPC
LLLANKCDLSPWAVSRDQVDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMSNSKEE
MSLSTQGNYINLHTKPTSSWTCC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccgcgatcacctgttcaaagtgctggtggtgggggatgccgcagtgggcaag
acgtccctggtgcagcggtattcccaggacagcttcagcaaacactacaagtccacggtg
ggagtggatttcgctctgaaggtgctccagtggtctgactcagaggtggtgcgcctccag
ctgtgggatattgcaggccaggagcgcttcacctctatgaccagactttactatcgggat
gcctctgcctgtgttatcatgtttgatgttaccaacgccactaccttcagcaacagccag
agatggaaacaggacctggacagcaagctcacactgcctaatggagggccagtgccctgc
ctgctcttagccaataagtgtgatctatccccttgggcggtgagccgagaccaggttgac
cggttcagtaaagagaacggcttcacaggttggacagaaacatcagtcaaggagaacaaa
aatattaacgaggcgatgagagtcctcattgaaaagatgatgagcaattccaaagaagaa
atgtctttgtccacccaagggaactacattaacctgcacaccaagcccacctccagctgg
acctgctgctaa

DBGET integrated database retrieval system