KEGG   Sus scrofa (pig): 100626439Help
Entry
100626439         CDS       T01009                                 

Gene name
SYT5
Definition
(RefSeq) synaptotagmin-5 isoform X1
  KO
K19905  synaptotagmin-5
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100626439 (SYT5)
Membrane trafficking [BR:ssc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    100626439 (SYT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 CEP76-C2 EphA2_TM WBP-1
Motif
Other DBs
NCBI-GeneID: 100626439
NCBI-ProteinID: XP_003356111
Ensembl: ENSSSCG00000021843
UniProt: A0A480Y3T9 A0A5K1V9N9 I3LFV7
Position
6
AA seq 386 aa AA seqDB search
MFPEPPTPGLPAPDTPPDSSRLSHGPVPPWALATIVLVSALLIFSCCFCLYRKRCRRRMG
KKSQAQAQVHLQEVKELGRSYIDKVQPEVEELEPAPSGPGQQVAEKHELGRLQYSLDYDF
QSGQLLVGILQAEGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGENFAFK
VPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVLAWRELQAAPREEQEKL
GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKN
TLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAGGAGLRHWADM
LANPRRPIAQWHSLRPPDRVRPPPAP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgttcccggagcccccaacacccgggcttccagcgcccgatacgccgccggactccagt
cgtctcagccacggccctgtgcccccctgggccctggccaccattgtgctggtctcagcc
ctcctcatcttcagctgctgtttctgtctctaccggaagcgatgtcggaggcggatgggc
aagaagagccaggcccaagcccaggtccaccttcaggaagtaaaggagctgggccggagt
tacatagacaaggtgcaaccagaagtggaggagctggaaccagcaccatctgggccaggg
cagcaggtggcagagaagcatgaactaggacgactacagtactcactggattatgatttc
cagagtggccagctgctggtgggcatcctgcaagctgagggactggcagccttggaccta
ggtggctcctctgacccctacgtgcgggtttacctgctgccagacaaacggaggcggtat
gagaccaaggtgcatcggcagacgctgaacccacactttggggagaactttgctttcaag
gtcccctacgtggagctgggaggcagggtcctggtcatggcagtgtacgacttcgaccgc
ttctcccgcaacgacgccatcggggaggtgcgggtccccatgagctctgtggacttgggg
cggccggtgctggcctggcgggagctgcaggccgctcctcgggaggagcaggagaaacta
ggtgacatctgcttctccctccgctatgtccccacggccgggaaactcactgtcatcgtc
ctggaggctaaaaacctgaagaagatggacgtgggagggctgtcagatccctacgtcaag
gtgcacctgctgcagggcggcaaaaaggtgcggaagaagaaaacgaccatcaagaagaac
accctgaacccctattacaacgaggccttcagcttcgaggtgccctgtgaccaggtccag
aaggtccaggtggagctgactgtgctggactacgacaagctgggcaagaacgaggccatc
gggagggtggctgtaggggcggcggccgggggggctggcctgcggcactgggcagacatg
ctggccaacccccggcggcccatcgcccagtggcactcgctgcggccccctgaccgggtg
aggccgccgccagccccctga

DBGET integrated database retrieval system