KEGG   Sus scrofa (pig): 100627083Help
Entry
100627083         CDS       T01009                                 

Gene name
VAMP7
Definition
(RefSeq) vesicle-associated membrane protein 7
  KO
K08515  vesicle-associated membrane protein 7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100627083 (VAMP7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100627083 (VAMP7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100627083 (VAMP7)
Membrane trafficking [BR:ssc04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    100627083 (VAMP7)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100627083 (VAMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin Longin PMT_4TMC IlvGEDA_leader
Motif
Other DBs
NCBI-GeneID: 100627083
NCBI-ProteinID: NP_001230522
Ensembl: ENSSSCG00000029615
UniProt: A0A4X1TWS7 I3LN62
Position
X
AA seq 220 aa AA seqDB search
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
KGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLAR
AMCMKNLKLTIIIIIISVVFIYIIVSPLCGGFTWPSCVKK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccattctttttgctgttgttgccaggggaaccactatccttgccaaacatgcttgg
tgtggaggaaacttcctggaggtgacagagcagattctggctaagataccttctgaaaat
aacaaactaacgtactcacatggcaattatttgtttcattacatctgccaagacaggatt
gtatatctttgtatcactgatgatgattttgaacgttcacgagcctttaactttctgaat
gagataaagaagaggttccagactacatatggttcaagagcacagacggcactcccatat
gccatgaatagtgagttctcaagtgtcttggctgcacaactgaagcatcactccgagaat
aagggcctagacaaagtgatggagactcaagctcaagtggatgaactgaaaggaatcatg
gtcagaaacatagatttggtagctcagcgaggtgaaagattggaattattgatagataaa
acagaaaatctcgtggattcgtctgtcaccttcaaaacaaccagcagaaatctcgcccga
gccatgtgtatgaagaatctcaagctcacaatcatcatcatcatcatatcagttgtattc
atctatattattgtgtcacctctctgtggtggatttacatggcccagctgtgtgaagaaa
taa

DBGET integrated database retrieval system