KEGG   Sus scrofa (pig): 100627703Help
Entry
100627703         CDS       T01009                                 

Gene name
C16H5orf22
Definition
(RefSeq) LOW QUALITY PROTEIN: UPF0489 protein C5orf22 homolog
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0489
Motif
Other DBs
NCBI-GeneID: 100627703
NCBI-ProteinID: XP_003359785
UniProt: A0A480Y8G2 A0A4X1TIX6
Position
16
AA seq 442 aa AA seqDB search
MSDSAGERPRLRCYPELPVWVVEDHQEVLPFIYRAIGSKHLPASNISFVHFDSHPDLLIP
VNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVIWLHPTWAEQIREGKHHFLVGKDT
STTTIRVTSTDHYFLSDGLYVTEDQLENPKPLQLDVIMVKPYKLCNNQEEKDTVSSAKKP
KLALEDGENPASTNGKSYSEGLEKDVVTQKRDQTCLQPSCSCSESQECQTTVSTGEILKI
LENRDAFILDIDLDFFSVKNPFKEMFTQEEYKILQELYQFKKPGTNLTEEDLVDCVDTRI
HQLXDLEAAFADLCDGDDEETVQKWASNPGMESLVPLVQSLKKRMEAPDYEMVHQAGLTC
DYSELPHHISTEKEIEYLIQSVYYVLKNLPKPTLVTIARSSLDDYCPSEQVDTIQEKVLS
VLRSLYGTLDIHLEYSAESAPS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactccgcgggagagcgcccccggctccggtgctacccggagctccccgtttgg
gtggtggaggatcatcaggaggttctgccttttatataccgggccattggctcaaagcat
cttcctgcaagtaacataagttttgtgcattttgattcacatccagacctccttattcct
gtgaatatgccagctgacactgtatttgataaggaaacgctttttggagaattaagtatt
gaaaattggattatgcctgcagtttatgctggccatttttctcacgtaatatggcttcat
cccacatgggctgagcaaatcagagagggcaaacatcactttttggtcggcaaagacact
tctacaacaacaatcagggttacaagtacagatcattacttcctaagcgatggtctttat
gtaactgaagaccagctagagaacccaaaacctttacaattggatgtgattatggtaaaa
ccttataaactctgtaacaatcaagaagaaaaagatacagtgtcctctgctaagaagcca
aagctagcactggaggatggagaaaaccctgcctctactaatggtaaatcttattcagaa
ggactggaaaaggacgtggtgacccagaaaagggaccagacctgtctacaaccatcatgt
tcatgttctgaaagccaggaatgccagactacagtgagcactggagaaattctgaaaatt
ttggagaacagggatgcatttattttagatattgacttagattttttttcagtcaaaaac
cccttcaaagaaatgttcactcaggaagagtacaaaatattgcaagagctgtaccaattt
aaaaagcctggtaccaacctgacagaggaagatctggtagattgtgttgatactcgaatt
catcaattangagatttagaagctgcttttgctgatttgtgtgatggtgatgatgaagag
actgtacagaaatgggcttcaaatcctggaatggaatcattagttccacttgtacagagt
ttgaaaaaacggatggaagcaccagactatgaaatggttcaccaggctggtctaacctgt
gattattcagaacttcctcaccatatcagcacagaaaaagaaattgaatatcttattcag
tctgtatattatgttctaaaaaatttaccaaaacctactcttgtgacaattgcaaggtca
agtctggatgattactgtccttctgagcaagttgacaccattcaagaaaaagtcctcagt
gtgctgcgctccctctatgggactctagacattcacctggagtactcagcagagtccgct
ccatcttga

DBGET integrated database retrieval system