KEGG   Sus scrofa (pig): 100627950
Entry
100627950         CDS       T01009                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100627950 (ADAMTS13)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100627950 (ADAMTS13)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100627950 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin ADAM_spacer1 Reprolysin_5 Reprolysin_2 Peptidase_M10 TSP1_CCN
Other DBs
NCBI-GeneID: 100627950
NCBI-ProteinID: XP_013842543
Ensembl: ENSSSCG00000021241
UniProt: A0A4X1SZQ6
Position
1
AA seq 1465 aa
MRVRDLRLRGRCVRGILTSLFLLGCWGLSRFPQLFLQALEPEEVTAYLGPAAALEGPSPS
ASPPTSPGRPPARRLWRRAAGSVLHLELLVAVGPDVQQAHQEDTERYVLTNLNMGSELLR
DPSLGAQFRVHLVKMVILTQPQDAPNITANITASLRSVCEWSRTVNPEDDADPSHADLVL
YITRFDLELPDGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGVTIAHEIGHSFGLEHDG
APGSDCEASGHVMASDGAAPARGGPTWSPCSRRQLQRMLSAGRPHCVWDPPGPQSWAAGR
PPEAHPGLYYGADEQCRVAFGPTAVACTFAREQLDMCQALSCHTDPLDQSSCSRLLIPLL
DGTECGVGKWCSKGHCRSLAELAPVGAVHGGWSSWGPASPCSRSCGGGVVTRRRQCNNPR
PAFGGRSCVGADLQAEMCNTQACEKTQLEFMSQQCAQTDGEPLRLSPGSTSFYHWGAAAQ
YSQGDTLCRHMCWAVGESFIVRRGDRFLDGTRCVPGGPRQDGTLSLCVSGSCRTFGCDGR
MDSGQVPDMCQVCGGDNSTCRPQNGSFTAGRAREYVTFLTVTPNLTNIHVINHRPLFTHL
AVRIRGRYVVAGNASISPSITYPSLLEDSRVEYRVALTEDRLPHREELRIRGPTQEDLEI
QVYRRYGQEYGRLARPDITFTYFQPEQQQAWAWAPVRGACSVSCGAGLRQVTYSCWDQAR
NAWVEAALCAGSRRPAAWSESCTPAPCPPFWAVGDFGPCSASCGGGLQERAVRCVEAQGG
LLRTLPRLRCRALAQQPAAVETCNAQPCPTRETSDTCPSACGAELAVQNVTCVQGAEGMG
ALATAGPCPTDQKPSALEPCIEVTCPPGWGHLEAQSPGEEAVSPAGSARLEVQAAHVWTP
LTGPCSVSCGQGLMELYFVCVDSALGTPVQEEMCDLAARPGRRQEVCQAAPCPAWWETRA
LAPCPVTCGGGQVPLAVRCVRMDRGRLVPLPHAKCWPLPRPRPFEDCSPEPCPARWRYKL
AACSVSCGGGVVQRILYCARAHGEDKDEEILPDTQCEGLPRPEQQEACSPEPCPPRWKVT
SLGLCSASCGLGTATRSVACVQLDQGRDTEVDGAACAGLVRPQASIPCVVADCAFRWHVG
AWMQCSVSCGDGIQRRHDACLGPQAQVPVPAVFCQHLPKPVTVQGCWAGPCAGQRTPSPA
SLEEATAPSQTTAATAGASPAWPQRGDRLLSLHPQEGPAESSACGQQYLEPTGTIDMRGP
EQADCAVVIGRPLGEVVTLRVLESSLNCSAGEMLLLWGRLTWRKKCERLSGMTFSTKANT
LMVRQRLVQLGGGVLLRYSSQPAPGTFHRECDMQLFGPRGEIVSPSTSPDGRHVGGCRIF
ISVAPRARIAIHALVTDAATGTDGTDASYVLIRDIHSLRTTAFHGQQTLYWESEGSQAEM
EFSQGFLDAHTSLRGQYWTLQKGVH
NT seq 4398 nt   +upstreamnt  +downstreamnt
atgagggtgagagaccttcgcctccgggggcgatgcgtgcgaggaatcctcacgtctctc
ttcctcctgggctgctgggggctctcccgtttcccgcagctatttcttcaggctttggag
ccggaggaagtgactgcttaccttggccctgctgccgccttggaaggaccctcgccgtca
gcctcgccacccacctcgccaggccgccctcctgcccggcgcctctggagacgggctgct
gggagcgtcctgcacctggagctgctggtggccgtgggtcccgatgtccagcaggctcac
caggaggacacggagcgctacgtgctcaccaacctcaacatggggtcagagctgctgagg
gacccgtccctgggggctcagttccgcgtgcacctggtgaagatggttattctgacacag
cctcaggatgctccgaatatcacagccaacatcaccgcatccctgcggagcgtctgtgag
tggagcaggacggtcaatcccgaggatgacgcagatcccagccacgccgacctcgtcctt
tacatcaccaggtttgacctggaattgcccgatggtaaccggcaggttcggggggtcacc
cagctggggggtgcctgctcctcctcttggagctgccttatcacagaggatactggcttc
gacctgggggtcaccatcgcccacgaaattgggcacagcttcggcctggagcacgacggt
gcgcccggcagcgactgcgaggccagcggccacgtgatggcgtccgacggcgccgcgccc
gcccgagggggccccacgtggtccccctgcagccgccggcagctgcagcgcatgctcagc
gcaggacgcccgcactgcgtgtgggacccgccggggccgcagtcctgggccgcgggccgc
cctcccgaagcgcaccctggcctctactacggcgccgacgagcagtgccgcgtcgccttc
ggccctacggcggtggcctgcaccttcgccagggagcagctggacatgtgccaggctctc
tcctgtcacacagaccccctggaccagagcagctgtagccgcctcctcattcctctcctg
gatgggacagagtgtggcgtggggaagtggtgctccaagggtcactgccgctccctggcg
gagctggcccccgtgggggcagtgcacgggggctggtctagctgggggcccgccagtcct
tgctcccgctcctgcggaggaggcgtggtcaccaggaggcgccagtgcaacaaccccaga
cctgcctttggggggcgctcgtgcgtaggtgctgacctccaggctgagatgtgcaacacc
caggcctgcgagaagacccagctggagttcatgtcccagcagtgcgcacagaccgacggg
gagcctctgcgcctctccccgggcagcacctccttctatcactggggcgccgccgcgcag
tacagccaaggggacactctgtgcagacacatgtgctgggcggttggcgagagcttcatt
gtgcggcgtggggacaggttcctggacgggactcggtgtgtgcccggcggcccccgacag
gacgggaccctgagcctgtgcgtgtcaggcagctgcaggacgttcggctgtgacggcagg
atggattccgggcaggtgccagacatgtgccaggtgtgcggcggggacaacagcacgtgc
aggccacagaacggctctttcacggctggaagggccagagagtatgtcaccttcctgact
gtcacccccaacctgaccaacatccatgtcatcaaccacaggcctctcttcacgcacctg
gctgtgcggatccgcgggcgctacgtcgtggctggaaatgccagcatctctcccagcatc
acctacccctccctcctggaggacagccgtgtcgagtacagagtggccctgactgaggac
cggctgccccaccgggaggagctccgcatccggggacccacccaggaggacctggagatc
caggtttacaggcgctacggccaggagtacggccgcctcgcccgcccagacatcaccttc
acctacttccagcctgagcagcagcaggcctgggcgtgggctcctgtgcggggggcctgc
tcggtgagctgtggggcagggctgcgtcaggtgacctacagctgttgggaccaggccagg
aatgcatgggtggaggctgccctgtgtgcagggagccggcggccggcggcgtggtccgag
tcctgcacccctgctccctgccccccattctgggcagttggagacttcggcccgtgcagc
gcttcctgcgggggaggcctgcaggagcgggcggtgcgctgtgtggaggcccagggtggc
ctcctaaggacgttgccccgcttgcggtgcagagcgctggcccagcaacctgcggccgtg
gagacctgcaacgcacagccctgccccacgagagagacatcggacacctgcccgtcagcc
tgtggagcagaactggccgtgcagaatgtgacgtgtgtgcagggggcagagggcatgggg
gcgctggccactgctgggccctgccccacagaccagaagccatctgccctagagccatgt
atcgaggtgacgtgtcctccaggctggggccatctggaggcccagtctccaggcgaagag
gctgtgtccccagcgggcagtgccaggctggaggttcaggccgcacacgtgtggactccc
ctgacggggccgtgctccgtctcctgtggtcaaggcctgatggagctgtatttcgtgtgc
gtggactctgccctcgggaccccggtccaggaagagatgtgtgacctggcagccaggcct
gggaggcggcaggaggtctgccaggctgccccgtgcccggcatggtgggagacccgagcc
ctggccccgtgcccggtgacctgcggaggtgggcaggtgccgctggctgttcgctgtgtg
cggatggaccgcggccgccttgtccccctgcctcatgccaagtgctggccgctgccccgg
cccaggccctttgaggactgcagccccgagccctgccctgccaggtggcggtacaagctg
gcggcctgcagcgtgagctgtggcgggggggtggtgcagaggatcctgtattgtgcccgg
gcccacggagaggacaaggacgaggagatcctgccggatacccagtgcgaggggctgcct
cgcccagagcagcaggaggcctgcagcccggagccctgcccgcccaggtggaaagtcaca
tcccttggcctgtgttcggccagctgtggtcttggcactgccacacgctcggtagcctgt
gtgcagctggaccaaggccgggacacggaggtggatggggcagcttgtgcgggtctggtg
cggccacaggccagcatcccctgcgttgttgccgactgcgccttccggtggcatgtcggc
gcctggatgcagtgctctgtctcctgtggggatggcatccagcgccggcacgacgcctgc
ctcggaccccaggcccaggtgcctgtgccagccgtcttctgccagcacttgcccaagcca
gtgaccgtgcagggctgctgggccgggccctgtgcaggccaaaggacgcccagccccgca
tctctcgaggaagccactgctcccagccagaccacagctgccactgctggtgcttccccg
gcgtggccccagcgtggggaccgcctcctctccctgcatccccaggagggcccagcggag
tccagtgcctgtggccagcagtaccttgaaccgacaggaaccattgacatgcgaggccca
gaacaggctgactgtgcagtagtcattgggcggcccctgggggaggtggtgactctgcga
gtccttgagagctccctcaactgcagcgctggggagatgctgctgctttggggcaggctc
acatggaggaagaagtgcgagagactgtctggcatgactttcagcaccaaagccaacacg
ctgatggtgaggcagcgtctcgtgcagctgggaggcggggtgctgctgcgatattcaagc
cagcctgcccctggaaccttccaccgagagtgtgacatgcagctctttggacccaggggt
gaaatcgtgagcccatcaacgagcccagatggaaggcatgtggggggctgccgcatcttc
attagcgtggctccccgggcccgcatcgccatccacgccctggtcacagacgcggccacc
ggaaccgatggcaccgatgccagctacgtcttgatccgggacatccacagcctgaggaca
acggcatttcatgggcagcagacgctctactgggagtcagagggcagccaggcagagatg
gagtttagtcagggcttcctggacgcccacaccagcctgcggggccagtactggaccctc
cagaaaggagttcattag

DBGET integrated database retrieval system