KEGG   Sus scrofa (pig): 100642182
Entry
100642182         CDS       T01009                                 

Gene name
PNPT1
Definition
(RefSeq) polyribonucleotide nucleotidyltransferase 1, mitochondrial
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100642182 (PNPT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ssc03019]
    100642182 (PNPT1)
   03016 Transfer RNA biogenesis [BR:ssc03016]
    100642182 (PNPT1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     100642182 (PNPT1)
Messenger RNA biogenesis [BR:ssc03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100642182 (PNPT1)
Transfer RNA biogenesis [BR:ssc03016]
 Prokaryotic type
  tRNA degradation factors
   100642182 (PNPT1)
SSDB
Motif
Pfam: RNase_PH RNase_PH_C KH_1 PNPase S1 RST
Other DBs
NCBI-GeneID: 100642182
NCBI-ProteinID: NP_001233196
Ensembl: ENSSSCG00000022880
UniProt: F8SIP3
Position
3
AA seq 784 aa
MAACRGCCSCLRLRPLGRGPFRLPGRDRTLTQLQVRALWSGGRSRTVAVDLGSRKLEISS
GKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRRE
IGSSDKEILTSRVIDRSIRPLFPAGYFDDTQILCNLLAVDGVNEPDVLAINGASVALSLS
DIPWNGPIGAVRIGMIDGECVVNPTRKEMSSSTLNLVVTGAPKSQIVMLEASAENILQQD
FCHAIKVGVKYTQQIIQGIQQLVKEIGVSKRTPQKLFVPSPEIVKHAHKLAMEKLYTVFT
DHEHDKISRDEAVNKIRLDTEEQLKEKYPEVDSYEIIESFNVAAKEVFRSIILNEYKRCD
GRDLTSLRNIKCEVDMFKILHGSSLFQRGQTQVLCTVTFDSLESSIKSDRIITAIDGIKD
KNFMLHYEFPPYATNEIGKVTGVNRRELGHGALAEKALYPVIPKDFPFTIRVTSEVLESN
GSSSMASACGGSLALMDAGVPISSAVAGVAIGLVTKNNPDKGEIEDYRLLTDILGIEDYH
GDMDFKIAGTAKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTIPKPRASR
KENGPVVETVQVPLSKRAKFVGPGGYHLKKLQAETGVTISQVDEETFSIFAPTPSAMHEA
KDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYSNMTAVLLHNTQLDQRKIKHP
TALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTIVKTLNDRNSIVMGECISQSSS
NSSQ
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcggcctgcaggggctgctgctcatgcctccggcttcggccgctgggcagaggtccc
ttccgtctgccagggagggatcggacactcacccagctgcaggtgcgagcactatggagt
ggcgggaggtcccgaaccgtggccgtggacttaggcagcagaaaattagaaatatcatct
ggaaaactggccagatttgcagatggctctgctgtagtacagtcaggtgacactgcagtg
atggttacagcagtcagtaaaacaaaaccttcaccttcccagttcatgcctttggtggtt
gactatagacaaaaggctgctgcagcaggtagaattcccacaaactatcttagaagagag
attggttcttctgataaagaaattcttacaagtcgagtaatagatcgttcaattagacct
ctctttccagctggctactttgatgatacacagatcctttgtaatctgttagcagtagat
ggtgttaatgaacctgatgtcctagcaattaatggtgcttctgtagccctctcattatca
gatataccttggaatggacctattggggcagtacgaataggaatgattgatggagaatgt
gttgttaacccaacacgaaaagaaatgtcttccagtactttaaatttagtggttactgga
gcacctaaaagtcagattgtcatgttggaagcctctgcagagaatattttacaacaggac
ttctgccatgctatcaaagtgggagtgaaatatacacaacaaataattcagggcatccag
cagttggtaaaagaaattggtgttagcaagaggacacctcagaagttatttgttccttca
ccagagattgtgaaacatgctcataaactcgccatggaaaaactctacacagtttttaca
gatcatgaacatgataaaatttccagggatgaagctgttaacaagattagattagataca
gaggaacaactaaaagaaaaatatccagaggttgattcatatgaaataatagaatccttc
aatgttgctgcaaaggaggtttttagaagtattattttgaatgaatacaaaaggtgtgat
ggtcgtgatttgacttcacttaggaatataaaatgtgaggtagatatgtttaaaattctt
catggatcatcattatttcaaagaggacaaacacaggtgctttgtactgttacatttgat
tcattagaatccagtattaagtcagaccggattataacagctatagatgggataaaggat
aaaaacttcatgctgcactatgagtttcctccttatgcaactaatgaaatcggcaaagtc
acaggtgtaaatagaagagaacttgggcacggggctcttgctgagaaagctttgtatcct
gttatccctaaagattttcctttcaccataagagtcacatctgaagtactagagtcaaat
gggtcatcttctatggcatctgcatgtggtggaagtttagcattaatggatgcaggagtt
ccaatttcatctgctgttgcaggtgtggcaataggattggtcaccaaaaacaatcctgac
aagggtgaaatagaagattatcgtttgttgacagatattctggggattgaagattaccat
ggtgacatggatttcaaaatagccggcactgctaagggaataactgcattacaggctgat
attaaactacctggaataccaataaaaattgtaatggaggccattcagcaagcctcagtg
gcaaagaaggagatattacagattatgaacaaaacaattccaaaacctcgagcatctaga
aaagaaaatggacctgttgtagaaactgttcaggttccattatcaaaacgagcaaaattt
gttggaccaggtggctatcatttaaaaaaacttcaggctgaaacaggagtaactattagt
caggtggatgaagaaacattttccatatttgcaccaacacccagtgctatgcatgaagca
aaagacttcattactgaaatctgcaaagatgatcaggagcagcaattagaatttggagca
gtgtacaccgctacaataactgaaatcagagacactggagtaatggttaaactttattca
aatatgactgcagtactacttcataacacacaacttgatcaacgaaagattaaacatccc
actgctttaggattagaagttggccaagaaattcaggtgaaatattttggacgtgatcca
gctgatggaaggatgcggctttctcgtaaagtgctccagtctccagccacaactattgtc
aaaactttaaatgacagaaacagtattgtaatgggagaatgtatttcacagtcatcatct
aattcttctcagtga

DBGET integrated database retrieval system