KEGG   Sus scrofa (pig): 100737265Help
Entry
100737265         CDS       T01009                                 

Definition
(RefSeq) small ubiquitin-related modifier 1-like
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 100737265
NCBI-ProteinID: XP_005659547
Ensembl: ENSSSCG00000004546
UniProt: A0A287BKM7 A0A4X1U4N3
Position
1
AA seq 101 aa AA seqDB search
MSDQEAKPSTEDLGDKRKGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGIPMN
SLRFLFEGQRIADNHTPKELGMEEEDVTEVYQEQTGGHSTV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaggaagcaaaaccttcaactgaggacttgggggataagaggaaaggagag
tacattaaactcaaagtcattggacaggatagcagtgagattcatttcaaagtgaaaatg
acgacacatctcaagaaactcaaagaatcatactgtcaaagacagggcattccaatgaac
tcactcaggtttctctttgaaggtcagagaattgctgataatcacactccaaaagaactg
ggaatggaggaagaagatgtgactgaagtttatcaggaacaaacagggggtcactcaacg
gtttag

DBGET integrated database retrieval system