KEGG   Sus scrofa (pig): 100737320Help
Entry
100737320         CDS       T01009                                 

Gene name
OLFM4
Definition
(RefSeq) olfactomedin-4
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF FPP Endopep_inhib Noelin-1
Motif
Other DBs
NCBI-GeneID: 100737320
NCBI-ProteinID: XP_003482951
Ensembl: ENSSSCG00000009444
UniProt: F1RJ68
Position
11
AA seq 681 aa AA seqDB search
MSVTVTEMPVWTYEGATAHYTLDGWTQKHGETSLQSSCGGLFEEGQPGPEGVERVAAAAG
LPAIINSLLLALSWGPQAHNHIRRKAEVTEVCGMVARCQWGQKTIVTCTLELIFGRTSPE
ANGSWQSGARSPGVQVTQVSRYCRPPGWSRAPQGASSFPKNCPDGEVPTGHYKKPPGAQG
SCREASGSSLEHKMWLGFLCLLALLDLHSAALSTTPRYFPTSYLSRSPTSISNWSSSSAE
SQSVSNFTGSVDDRGTCQCSVILPDTTFPVERVERLEITAQTISKKFEKELSKVREYVQL
ISIYEKKLLNLTVRIEKIEQDTISYTELDFELIKIEVREMEKLIQQLKVGFVGSTVIIDQ
LEVEIRNMTLLVEKLETLDKNNVLNIRRQILALKNKLKECETSKLEDPARPPPPAPGSCT
HGGVVNVSKPAIVQLNWLGFSYKYGAWGRDYSPQLPGKGLYWVAPLNTNGRTLQNYRLYN
TLDDLLLYRYNQDYYISYGQGSGIAVYNNNMYVNWYNTRNIARVNLATNRVEVTQTLPQA
AYNNRFSYANVGWQDIDLAVDENGLWVIYATEASTGNIVISKLNDTTLAVLNTWHTKQYK
PSVSNAFMVCGVLYATRTLSTRAEEIFYYFDTNTGQEGRLAIVMQKVQETLQSINYHPYE
QKLFVYNDGYLLNYDLFFQPQ
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgacagtgacagaaatgccagtctggacatatgaaggggccacggctcattac
accttggacggttggacccagaagcatggagaaacaagtttgcagagcagttgtggagga
ctcttcgaagaaggacaaccaggccccgagggggtggagcgggttgctgcagccgctggc
ttgccagcaattattaattcactcctgctggcgctgtcttgggggccccaggctcacaac
cacatcaggaggaaggcagaggtcacggaggtgtgtggaatggtggcgaggtgtcagtgg
ggccagaagaccatcgttacctgcacacttgagttaatatttggcaggacatccccagaa
gctaatggcagttggcagagtggggctcggagccctggtgtgcaggtgactcaggtttcc
cggtattgtcgccctcctggctggtcacgtgcccctcaaggggcttcctctttccctaaa
aactgccctgatggggaagtccccactgggcactataagaagccccctggggctcagggc
tcctgcagagaagccagcggctccagcctagagcacaagatgtggctgggtttcctctgc
ctgctggcccttctggacctccactctgcggctttgagcaccaccccgagatacttcccc
acgtcctatctcagccgcagccccacgtccatctctaactggtccagctccagcgccgaa
tcccagtcggtttccaatttcactggctccgtggatgaccgtgggacctgccagtgctcc
gttatcctgccagacaccacctttcccgtggagagagtggagcgcttggaaatcacagct
caaactatctccaagaagttcgagaaagagctttctaaagtgagggagtatgtgcaatta
atcagcatatatgaaaagaaactcttaaacctcaccgtccgcatagagaaaatagagcaa
gataccatttcttacacggaactagactttgagctgatcaagatagaagtcagggagatg
gagaaactgatccagcagctgaaggtcggttttgtgggcagcacggtgatcattgaccag
ctggaagtggagataaggaatatgactctcctggtagagaagctcgagacgctagacaaa
aacaatgtcctaaacattcgccgacaaatcctggctctgaagaacaagctcaaggaatgt
gagacctccaaactcgaggatcctgccagaccccctccaccggcgccagggagctgtact
cacggcggtgtggtgaatgtcagcaaaccggctattgttcaactcaactggctagggttt
tcctataagtatggcgcctggggtcgggattattctccccagcttccgggcaaagggctg
tactgggtggcacctttgaatacaaatgggagaactttgcaaaattatagactctacaat
accctggatgatctgctgctgtacaggtataaccaggactattatatttcctatggccaa
ggcagtggcatagcagtttataataacaacatgtatgtcaactggtataacaccaggaac
attgccagagttaacctggccaccaacagggttgaggtgacacaaacactccctcaggct
gcctataataaccgcttttcatatgctaatgttggctggcaagacatagacttggctgtg
gatgagaatggattgtgggtgatttacgcaactgaagccagcactggtaacatagtgatt
agtaaactcaatgacaccacacttgcggtgctaaacacttggcataccaagcagtacaaa
ccatctgtttctaacgccttcatggtgtgcggggttctgtacgccacccgtactttgagc
accagagctgaagagattttctactactttgacacaaacacagggcaagagggcagactg
gccattgtcatgcagaaggtgcaagaaaccttgcagagcatcaactaccacccttatgag
cagaaactttttgtctataatgatggttaccttctgaattatgaccttttcttccaaccc
cagtaa

DBGET integrated database retrieval system