KEGG   Sus scrofa (pig): 100737360Help
Entry
100737360         CDS       T01009                                 

Gene name
CAMKMT
Definition
(RefSeq) calmodulin-lysine N-methyltransferase isoform X1
  KO
K18826  calmodulin-lysine N-methyltransferase [EC:2.1.1.60]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00310  Lysine degradation
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100737360 (CAMKMT)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.60  calmodulin-lysine N-methyltransferase
     100737360 (CAMKMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_16 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 100737360
NCBI-ProteinID: XP_020943960
Ensembl: ENSSSCG00000008447
Position
3
AA seq 323 aa AA seqDB search
MEPRVTDAEAGQVESAKNENPARGSAARGPVVAAPLAAARWKLLRQVLKQKHLDDCLRHI
SVRRFESFNLFSVTETNKKEAEEEIGTWVQYTSIFFPECSVSLRHNSGSLNVEDVLTSFD
NTGNVCIWPAEEVLAYYCLKHSNVFRDLAVCELGGGMTCLAGLMVAISADVKEVLLTDGN
EKAIRNVRDIIARNQKAGVFKTGNISCCVLRWDNETDVSQLEGHFDIVMCADCLFLDQYR
ASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFSIQRHENYDEHISNFHSKLK
KENQDLYEENLHYPLLLILTKDG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcgagtcacagacgccgaggccggccaggttgagagcgccaagaacgagaat
ccggcaaggggtagcgccgctcggggacccgtagtcgcggcacctttggctgcagcccgg
tggaagctcctgcggcaggttctgaagcaaaaacatctagatgattgtctgcgacatata
tctgtgagaagatttgaatcatttaatctgttttcagtaacagaaaccaataaaaaggaa
gccgaagaggaaattggcacctgggtccaatatacaagcatcttctttcctgaatgcagt
gtttctttaaggcataatagtggatctttgaatgttgaagatgttcttaccagctttgac
aatacaggaaatgtttgcatctggccggctgaagaggttttggcttactactgcctcaag
cacagtaatgtattcagggaccttgctgtgtgtgagctagggggtggcatgacatgcttg
gctgggctcatggttgctatttctgcagatgtcaaagaagttctgttaactgatgggaat
gaaaaggccatcagaaatgtgagagacatcatcgcaaggaatcagaaggctggtgtgttt
aagactgggaacatatcatgctgcgttttacgatgggataatgagacagatgtctctcaa
ctggaaggacattttgacattgttatgtgtgctgactgcctatttctggaccagtacaga
gccagccttgttgatgcaataaagagattactccagcccagggggaaagcaatggtattc
gccccgcgccgagggaatactttaaaccagttttgcaatctagctgaaaaagctggtttc
tctatccaaagacatgaaaattatgatgaacacatttcaaacttccactccaagttgaaa
aaggaaaaccaggatctatatgaagaaaaccttcactacccacttctgcttattttaacc
aaagatggctag

DBGET integrated database retrieval system