KEGG   Sus scrofa (pig): 100738372
Entry
100738372         CDS       T01009                                 

Gene name
CDC42EP1
Definition
(RefSeq) cdc42 effector protein 1
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: BORG_CEP PBD
Other DBs
NCBI-GeneID: 100738372
NCBI-ProteinID: XP_003481602
Ensembl: ENSSSCG00000026108
UniProt: A0A480P3R5 A0A4X1UTJ1
Position
5
AA seq 376 aa
MPGPQGAGGTPAMSLGKLSPVGWVSSSQGKRRLTADMISPPLGDFRHTMHVGRGGDVFGD
TSFLSNHGGSSGGTHRSPRNFLAKKLQLMRRVGTPPRRMASPPAPSPAPPAVSPIIKNAI
SLPQLNQAAYDSLVVGKLSFDRSPATSTDGHSSYGLDSGFCTISRLSRPEKPRDRDRENS
FPSEPELRRSDSLLSFRLDLDLGPSLLSEMLGVMSLSEASAAETPAPAPAANSPAPAANP
PAPAATPLSPLGKPSGPASSPPPRGHCPNGVTARLGSVAEARASPVGEHPPAPADMAPGR
RWGAGWGGSQSSSRHYPEVDARREPVGMLSQAQSSWESLDDEWGAAQAGSRAPVPSTVQA
NTFEFADAEEDDEVKV
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgccgggtccccagggggccggaggaaccccggccatgagcctgggcaagctctcgccc
gtgggctgggtgtccagctcgcaggggaagagacggctgacagcggacatgatcagcccc
cccctcggggacttccgccacaccatgcacgtgggccgcggcggggacgtcttcggcgac
acctccttcctcagcaaccacggtggcagctccgggggcacccaccgctcgccccgcaac
ttcctggccaagaagctgcagctgatgcggagggtggggacaccgccgcggcgaatggct
tccccgcccgcgccgtcgccggctccgcccgccgtctcccccatcatcaagaacgccatc
tccctgcctcagctcaaccaggccgcctacgacagcctcgtggtgggcaagctcagcttt
gaccgcagccccgccacctccacggacggccactccagttacggcctggactctggattc
tgcaccatctcccgcctgtctcgtccagaaaagcctcgtgaccgagaccgtgagaactcc
ttcccctctgagcctgagcttcgccgctctgactccctcctgtccttccgcctggacctc
gaccttgggccctctctcctcagtgagatgctgggggtcatgagcctctcagaagcctct
gcggctgagaccccagccccagcccctgctgcaaattccccagccccagctgcaaatccc
ccggccccagctgcaacccccctgtcccctctgggaaagccctcaggccctgcctcaagc
cccccaccccgtggacactgccccaatggggtaactgctaggttgggctcagtggctgag
gccagggccagtccagtaggagagcatcccccagcacctgctgacatggcccctggccgg
cgctggggagcaggctggggtggcagccaaagcagcagccgccactaccctgaggtggat
gctcggcgggagccagtggggatgctgtcccaggcccagtcctcttgggagagcctggac
gacgagtggggggcagcccaggcaggcagcagggcccccgtgcccagcacggtgcaagcc
aacaccttcgagttcgctgatgctgaggaggatgatgaggtcaaggtgtga

DBGET integrated database retrieval system