KEGG   Sus scrofa (pig): 100738802
Entry
100738802         CDS       T01009                                 

Gene name
BCAN
Definition
(RefSeq) brevican core protein isoform X2
  KO
K06795  brevican
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:ssc00535]
    100738802 (BCAN)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100738802 (BCAN)
   04091 Lectins [BR:ssc04091]
    100738802 (BCAN)
Proteoglycans [BR:ssc00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   100738802 (BCAN)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   100738802 (BCAN)
Lectins [BR:ssc04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   100738802 (BCAN)
Motif
Pfam: Xlink Lectin_C V-set Sushi EGF hEGF EGF_2 EGF_3 ig I-set Ig_2 Izumo-Ig Ig_3
Other DBs
NCBI-GeneID: 100738802
NCBI-ProteinID: XP_003481480
Ensembl: ENSSSCG00000006477
UniProt: F1RP38
Position
4
AA seq 906 aa
MAPLFLPLLAALALAPVPAALADALEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVH
YLRPPPSRRAALGSPRVKWTFLSRGREAEVLVARGLRVKVSEAYRFRVALPGYPASLTDV
SLVLSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFTGAQEACA
RIGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEELNGELFLGAPPDKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDR
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSTQPS
AIPEASNPASDLASDALEAIVTVTETLEELQLPQEAVESESRGAIYSIPIMEDGGGGSST
PEDPAEAPRTLLEFETQSIVTPLGSSEEESQVLEEEEKFEEEEEEEEVEDKALWAWPSEP
GSLHPEATLPTESAPEESLSQASPPARAVLQPGASSPPYGEPEAPRPPRVLGPPTETPPT
PREGNLASPPSSTLVGARDIGVDTGGPELSGVPRGESEETGSSEDAPSMLPATRAPEGTR
ELEIPSEEHSGRTVPAGTSVRAQPVLPTDSASRGGVAVAPSSGDCVPSPCHNGGTCLEEE
EGVRCLCLPGYGGDLCDVGLRFCSPGWDSFQGACYKHFSKRKSWEEAENKCRMYGAHLAS
ISTPEEQDFINNQYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCV
VMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLRYRCR
EGLTQRNLPLIRCQENGRWETPQISCVPRRPARALHPVKAPEGRQRRLLGHWKTRSTPPP
NPASGP
NT seq 2721 nt   +upstreamnt  +downstreamnt
atggccccactgttcctgcccctgctggcagcactggctctggccccggtccctgcggcc
ttggctgatgctctggaaggggacagctcagaggaccgggccttccgcgtgcgcatcgcc
ggcgacgcgccgctgcagggcgtgctgggtggcgccctcaccatcccgtgccacgttcac
tacctgcggccgccgccgagccgccgggccgcgctgggctccccgcgggtcaagtggacc
ttcctgtctcggggccgggaggccgaggttctggtggcgcgggggctgcgcgtcaaggtg
agcgaggcctaccggttccgcgtggcactgcctgggtacccggcgtcactcaccgatgtc
tccctggtgctgagcgagctgcggcccaacgactcgggcatctaccgctgcgaggttcag
cacggcatcgatgacagcagcgacgctgtggaggtcaaggtcaaaggggttgtctttctc
taccgagagggctctgcccgctacgctttctccttcactggggcccaggaagcctgtgcc
cgcatcggagcccgaatcgccactccggagcagctctatgccgcctacctcgggggctat
gaacagtgtgatgctggctggttgtctgaccagactgtgaggtatcccatccagactcca
cgagaggcctgttatggagacatggatggcttccctggggtccggaactatggagtggta
gacccggatgacctctatgatgtctactgttatgctgaagaattaaatggagagctgttt
ctgggtgcccctccagacaagctgacgttggaggaggcacgtgcatactgccaggagcgg
ggtgccgagattgcaaccacgggccagctgtatgcagcctgggatggtggcctggaccgc
tgcagcccaggctggctggctgatggcagtgtgcgctaccccatcgtcacacccagccag
cgctgtggtgggggcctccctggtgtcaagactcttttcctctttcccaaccagacgggc
ttccccaacaagcacagccgcttcaacgtctactgcttccgagactctactcagccctct
gccatccctgaggcctccaacccagcctctgatctggcctctgatgcactggaagcaatt
gtcacagtgacagagaccctggaggagctgcagctgcctcaggaagctgtggagagtgag
tcccgaggagccatctactccattcctatcatggaagatggaggaggtggaagctccact
ccagaggacccggcagaggccccgaggacccttctagagtttgaaacccaatccattgta
acccccctggggtcctcagaagaggaaagccaagtgttggaggaagaagagaaattcgag
gaagaagaagaagaggaggaggtggaggataaggcgctgtgggcctggcccagcgagcct
ggcagtctgcacccagaagccactctccccaccgagtcagctccagaggagtcactctcc
caggcatccccaccagcaagggcagtcctacagcctggtgcatcatcacctccttatgga
gagccagaggctcccaggcctccaagggtccttggaccacccacggagaccccgcccact
cccagggaggggaacctggcatccccaccatcttccactctggttggggcaagagacata
ggggtggatactgggggtcctgagctgtctggggtccctcgaggagagagtgaagagaca
gggagctccgaggatgccccttccatgcttccagccacacgggcccctgagggtaccagg
gagctggagatcccctctgaagaacattctggaagaactgtcccagcagggacttcagtg
cgggctcagccggtgctgcccactgacagtgccagccgtggtggagtggccgtggccccc
tcatcaggtgactgtgtccccagcccctgtcacaatggtgggacgtgcttggaggaggag
gagggggtccgctgcctatgtttgcctggctatgggggggacctgtgcgatgttggcctc
cgcttctgcagccctggctgggactccttccagggcgcctgctacaagcacttttctaag
cgaaagagctgggaagaggcggaaaacaagtgccggatgtacggcgcgcacctggccagc
atcagcacgccggaggaacaggacttcatcaacaatcaataccgggagtaccagtggatt
gggctcaacgataggaccatcgaaggcgatttcctgtggtcagatggcgtccccttgctc
tatgagaactggaacccagggcagccagacagctacttcctgtccggagagaactgcgtg
gttatggtgtggcacgatcagggacaatggagcgatgtgccctgcaactaccacctgtcc
tacacctgcaagatggggctggtgtcctgtgggcccccaccggagctgcccctggctcaa
gtgtttggccgtccacggctgcgctatgaagtagacacggtgcttcgttaccggtgtcgg
gagggactgacccagcgcaacctgccactgatccgctgccaggagaatggtcgctgggag
acccctcagatctcctgtgtgccccgcaggcctgctcgagctctgcacccagtaaaggcc
ccagagggacgtcagaggaggctactggggcactggaagacacggtcaaccccccctccc
aatcctgcttcaggtccctaa

DBGET integrated database retrieval system