KEGG   Sus scrofa (pig): 100739578
Entry
100739578         CDS       T01009                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100739578 (ANKRD53)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100739578 (ANKRD53)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 100739578
NCBI-ProteinID: XP_005662540
Position
3
AA seq 466 aa
MQLAEKVSLRATCSDSAAERPSLVNNLEEKWNQKAIGNYYELFAASLGNLEWLRFCLDRH
GEVIPADDKGFTAIHFAAQRGKLACLQVLVEEYNFPVNLPTKNGQTPLHLVIHSDNKTMA
LPCIRYLIQQGAALNTQTCNGSTPLHLAAREGLLSCVKALVQNGANVHAQDAMGCKPIDY
CKIWNHRICARFLKDAMWKQDKKDFACEMRNLKRLKDQLALMEQDHLTEYQRKHQILRDA
EVKKWLHRKLLPRGQSLIHSTQQEPQATAISKTPKQRGLWPPKSLHPSPEARLQQTLEPK
LPLVMRSPTYKQPRLRRPKVWNLSNNPARSPTAQIGYPQGIRLGVHPDSKLEHDFRCFLE
VRPDGHGGARLCTVAGKQVAPVPRLPFEVIIRELYPSERPYRMKVPQGFYSVTMSHVPRK
RHLGDSIFWTDTLNMNLRETFDEAFLAAVRAHQGLPALSSPKASPP
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgcagctggcggagaaagtctctctgagggccacctgcagcgactcggctgccgagcgg
cccagcttagtgaacaacctagaagagaagtggaaccagaaggcgatcgggaactactat
gagctgttcgccgcctcgttgggcaacctggaatggttgcggttctgtctagatcggcac
ggtgaggtaatcccggctgatgacaagggtttcaccgccatccactttgcagcccagaga
ggcaagctggcatgcctgcaggtcttggtagaggagtacaattttcctgtgaacctgccc
accaaaaatggccagacacccctgcaccttgtcatccacagtgacaacaagaccatggcc
ctcccctgcattcgctatttgattcagcaaggggcggccctcaacacccagacatgcaac
ggctccacacccctgcacctggcagcccgagagggtctgctgagctgtgtgaaggccctg
gtgcagaatggtgccaacgtccatgcccaagatgccatgggctgtaagcccatcgactac
tgcaaaatatggaaccaccgcatctgtgcccggttcttgaaggatgccatgtggaaacag
gacaagaaggactttgcctgtgagatgaggaatctgaagaggcttaaggaccagctggcc
ctcatggagcaggaccacctgactgagtatcaaagaaagcaccaaattctgagagatgct
gaggtcaagaagtggctccatcgcaagctgctgccccgaggccaatccctgatccacagc
actcagcaagagccccaggccaccgccatctccaagactcctaagcagcgaggactctgg
cctcccaagagcttgcacccctccccggaagcacgcctgcaacagacactggagcccaag
ctgcctctggtgatgcgtagtcccacctacaagcagcccaggctcaggcggcccaaggtg
tggaatcttagcaacaaccctgccaggtcccccactgcccagatcggctacccgcagggc
atccgcctgggcgtgcatcccgactccaagctggaacacgacttccgctgcttcctcgag
gtcaggcctgacgggcatggtggcgcacgtctgtgcacggtggccggcaaacaggtggca
cctgtgccccggctgccttttgaggtaataatccgtgagctgtatccttcggagaggccg
tacaggatgaaggtgccccagggcttttactctgtcaccatgagccatgtgccccggaag
cggcacctgggtgacagcatcttctggacagacactctgaacatgaacctgagagagaca
tttgacgaagccttcctggcagctgtgcgagcccatcaagggctccctgctctgtcctcc
cccaaagcatcccccccttaa

DBGET integrated database retrieval system