KEGG   Sus scrofa (pig): 102158443
Entry
102158443         CDS       T01009                                 

Definition
(RefSeq) zinc finger protein 606 isoform X1
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102158443
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    102158443
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    102158443
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz zinc_ribbon_15 zf_C2H2_13 HalOD2 zf-AN1 DUF3268
Other DBs
NCBI-GeneID: 102158443
NCBI-ProteinID: XP_005664991
Ensembl: ENSSSCG00000003995
UniProt: F1SC26
Position
6
AA seq 796 aa
MAAINPWASWGILTDHSWGIAAVDPWASWALCPQDPAWRVEETPEERRRGPGLPSAQARE
LVTFKDVAVDFTQEEWGQLDPVQRTLYRDVMLETYGHLLSVGHQMAKPEVISLLEQGEEP
WSTEQPYSPPGTCPEWMRNLESKALIPTRSIFEEEQSHSVKLERYIWDDPWFSRLEVLGC
KDQLEVCRMNQSTAMRQMVFMQKQVLSQRGSEFCELGTGCSQSLNIVPSQKVSQIEHFYK
PDTNAESWRCNSAIMYADKLTCEHSEYDKAFYQSVQPVHPARGHTGDNIFKCTDAVTSFN
HILHFGDHMGMHTGEKLYEYKECHQIFNQSPSFSEHPRLHIGGNQYDYKEYENIFYFSSF
MEHQKIGTVETAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYEYNECGTSFIWSSYLIQHK
KTHTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHT
GEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKP
FKCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQ
ECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGK
SFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNE
SSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNDCGKAFSGHSAL
LQHRRSHSEEKLCELN
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggcagccatcaacccttgggcctcctggggtatccttacggaccactcctgggggata
gcggctgttgatccgtgggcctcctgggctctctgtcctcaggaccctgcctggcgcgtg
gaggagacccctgaggagaggaggaggggccccgggctcccatcagctcaggcgcgggaa
ctagtgaccttcaaggacgtggccgtggacttcacccaggaggagtgggggcagctggac
ccggttcagaggaccctgtaccgtgatgtgatgctggagacctatgggcacctgctctct
gtggggcatcagatggccaagcccgaggtcatctccctcttggagcagggagaagagccg
tggtccacagagcagccgtattctcctccaggcacctgtccagaatggatgagaaatctt
gaaagcaaagcgttgatcccaacacgaagcatttttgaggaggaacagtcccatagcgtg
aagttggagcgatacatatgggatgatccttggttctccaggttagaagttttgggatgt
aaagaccaattagaagtgtgtcgcatgaaccagagcacagctatgaggcagatggtcttc
atgcaaaagcaagtactgtctcaaagaggctctgagttctgtgaacttgggacaggatgt
agccagagcttaaacattgttccgtctcagaaagtctctcagatagaacacttttataag
cctgatacaaatgctgaaagttggagatgtaactcagccataatgtatgcagataagctt
acctgtgaacatagtgagtatgacaaagccttctaccagtccgtgcaacctgttcaccct
gcaagagggcacactggagataatattttcaagtgtactgatgctgttacatctttcaat
catatactgcattttggtgatcacatgggaatgcatacaggagaaaaactctatgaatat
aaggaatgccaccaaatctttaaccagagcccatcatttagtgaacatcccagacttcat
attggaggaaaccagtatgactacaaggaatatgagaatatcttttacttctcatccttt
atggagcatcagaaaattggtactgtagagacagcatataaatacaatgaatgggagaaa
gtctttgggtacgactcattccttacgcaacacacaagcacttacactgcagagaaacct
tatgaatataatgaatgtgggacgtctttcatctggagctcttaccttatccagcataag
aaaactcatactggagagaaaccctatgaatgtgataaatgtggaaaagtttttaggaat
cgttcagcccttactaaacatgaacggactcacactggaataaaaccctatgaatgtaat
aaatgtgggaaagcctttagctggaattctcatcttattgtacacaagagaattcatacg
ggagagaaaccttacgtatgtaatgaatgtgggaagtctttcaactggaactcccatctt
attggacatcagagaactcatactggagagaaaccttttgaatgtactgaatgtgggaaa
tctttcagctggagctcccatcttattgcccacatgagaatgcatactggagaaaagccc
tttaaatgtgatgaatgtgaaaaagcttttagggattactcagcccttagtaaacatgaa
agaactcactctggagcaaaaccgtataaatgtactgaatgtggaaaatccttcagctgg
agctcccaccttattgcccatcagagaactcacacaggagaaaagccctacaactgccag
gaatgtggtaaagcattcagagaacgttcagccctcactaaacatgaaataattcattct
ggaattaaaccctatgagtgtaataaatgtggaaagtcctgcagccaaatggctcacctt
gttagacatcaaaggactcatactggagaaaagccctatgaatgcaataaatgtggaaaa
tccttcagccagagctgtcatcttgttgctcatcggagaattcacactggtgagaaaccc
tacaagtgtaaccaatgcgaacgatcctttaattgtagttctcatcttattgcacaccgg
agaactcatactggagagaaaccatatagatgtaatgaatgtgggaaagcgtttaatgag
agttcttcccttattgtgcacctgagaaaccatactggagaaaaaccctacaaatgtaat
cattgtgagaaagctttctgtaagaattcttctcttattattcatcagagaatgcatagt
ggagagaaacgctttatatgcaacgactgcggaaaagcctttagtggccactcagcgcta
cttcagcaccggagaagtcatagtgaagagaaactctgtgaattgaattga

DBGET integrated database retrieval system