KEGG   Sus scrofa (pig): 102163020
Entry
102163020         CDS       T01009                                 

Gene name
PLSCR3
Definition
(RefSeq) phospholipid scramblase 3
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: Scramblase
Other DBs
NCBI-GeneID: 102163020
NCBI-ProteinID: XP_005669264
Ensembl: ENSSSCG00000029391
UniProt: I3LHI3
Position
12
AA seq 297 aa
MAGYIPPKGYAPSPPPPYPVTAGYPEPALHPGPGPSQAPVPAHVPAPAPGFALFPSPGPA
APGPAAPFLPVPGVPFGLEFLVQIDQILIHQKAERVETLLGWETCNRYELRSGAGQPLGQ
AAEESNCCARLCCGARRPLRVRLVDPGDREVLRLLRPLHCGCSCCPCGLQEMEVQSPPGT
TIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTPDESRSVGRISK
QWGGLLREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcaggctacataccccccaagggctacgccccttcgcccccacctccctatcctgtg
accgctgggtacccggagccggcgctgcatcctgggcccgggcccagccaggcgccagtg
cctgcccacgtgcctgccccagcgcccggctttgctctcttcccctcgcccggccctgcg
gccccggggccagctgcccccttcttgccagtgcccggggtgcctttcggcctcgaattc
ctggtgcagattgatcagatcttgattcaccagaaagctgagcgggtggaaacgctcctg
ggctgggagacctgtaaccggtacgaactgcgctcgggggccggacagcccctaggtcag
gctgcagaggagagcaactgctgtgctcgtctgtgctgtggcgcccgtcggcccctgcga
gtccgcctggtggaccccggggaccgagaggtgctccgcctgctccgccctctccattgt
ggctgcagctgctgtccgtgcggcctccaggagatggaagtacagtctccaccgggcacc
accattggccatgttctacagacctggcatcccttcctccccaagttctccattcaggat
gctgatcgccagacggttttgcgagtagtgggcccctgctggacctgtggctgtggcaca
gacaccaactttgaggtgaagaccccggacgaatcccgcagcgtaggccgcatcagcaag
cagtggggcgggctgctccgagaggccctcaccgacgccgatgacttcggcctgcagttc
ccgctggacctggacgtgagggtgaaggctgtgctgctgggcgccacattcctcatcgac
tacatgttcttcgagaagcgaggaggcgccgggccctcagccgtcaccagttag

DBGET integrated database retrieval system