KEGG   Sus scrofa (pig): 106509327
Entry
106509327         CDS       T01009                                 

Symbol
TMEM179B
Name
(RefSeq) transmembrane protein 179B
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: CASP_dom DUF6057 Ycf4
Other DBs
NCBI-GeneID: 106509327
NCBI-ProteinID: XP_013849655
UniProt: A0A287ATC0 A0A4X1VKE4
Position
2:complement(8983822..8986106)
AA seq 218 aa
MALLWLQRFELLLFAATFLCGAVAAVALTRTQGSFRGSCPLYGVATLNDSSLALSRPSAP
SLCYFVAGASGLLALYCLLLLLFWVYCSCIENSQRGRTGLCIVLAISAVAIFLVLVSACI
LRFGTSSLCKSIVSLNITSCSDAQRTPWIPPGTALQFYSNLHNAETSSWVNLVLWCMILV
LQVVQRKSEATPNWPLERGDPEWRSETDVLVGPRLSHS
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcgctgctctggttgcagcgcttcgagcttctgctctttgctgctactttcctgtgc
ggagccgtggcggccgtggcgctgacccggacccagggctccttcaggggcagctgtccc
ctgtatggtgtggccaccctgaatgactcctccttggccctgtcccgaccctcggcccca
tccctctgctactttgtggctggggcttctggcctactggccctctactgtctcctgctt
ctgctcttctgggtctactgcagctgcatcgagaactcccaaagaggccgtacggggctc
tgcattgtattggccatctcagctgtagccatcttcctggttttagtgtctgcctgtatc
ctccgatttggcaccagttccctctgcaaatccatcgtctccctgaacataactagctgc
tctgatgctcagagaactccatggataccccctggaaccgctctgcagttttactccaac
ctacacaatgctgaaacctcctcttgggtgaatctggtattgtggtgtatgatcttggtg
ctccaagtcgtgcagcggaagtctgaagccaccccaaactggcctctggagagaggtgac
cctgagtggaggtctgagacagacgttcttgttgggccccgcctttcccattcctga

DBGET integrated database retrieval system