KEGG   Sus scrofa (pig): 106509723
Entry
106509723         CDS       T01009                                 

Gene name
OGN
Definition
(RefSeq) osteoglycin precursor
  KO
K08126  osteoglycin (osteoinductive factor, mimecan)
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:ssc00535]
    106509723 (OGN)
Proteoglycans [BR:ssc00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    106509723 (OGN)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_5 LRR_9
Other DBs
NCBI-GeneID: 106509723
NCBI-ProteinID: NP_001302657
Ensembl: ENSSSCG00000008074 ENSSSCG00000030143
UniProt: A0A0H5ANC0 A0A4X1TYW8
Position
3
AA seq 298 aa
MKTLQSTLLLFLFVPLIKPAPPSQQDSRIISDYGTNNFEETLFSQDYEDKYLDGKSIKEK
EAIRIPDEKSFELQKDESTIPLSPKKENDEMPTCLLCVCLSGSVYCEEIDIKAVPPLPKE
SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELILADNQLL
KLPVLPPKLTLFNAKRNKIKSRGIKANAFKKLNKLSFLYLDHNALESVPLNLPESLRIIH
LQGNNITSITDDTFCKANDTSYIRDHIEEIRLEDNPIILGKYPNSFICLKRLPIGSYI
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaagactctgcaatctacacttctcttgttcctgtttgtgcctctgataaagccagca
ccaccatctcagcaggactctcgcattatctctgattatggaacaaataattttgaagaa
accttatttagccaagattatgaggataaatacctggatggaaaaagtattaaggaaaaa
gaggctatcagaatacctgatgagaaaagttttgaattacaaaaagacgagagtacaata
ccattatcccccaagaaagaaaacgatgaaatgcccacatgtctgctgtgtgtttgttta
agtggctctgtatactgtgaagaaattgacattaaagctgtaccacccttgccaaaggaa
tcagcctatctttatgcacgattcaacaaaattaaaaagttgactgccaaagattttgca
gatatacctaacttaagacgacttgattttacgggaaatttgattgaagatatagaagat
ggcactttctcaaaactctctctgttagaagaacttatactagctgacaatcaactactg
aaacttccagttctccctcctaagcttacgttatttaatgcaaaacgcaacaaaatcaag
agtaggggaataaaagcaaatgcattcaaaaaattgaataaactctccttcctctacctg
gaccacaatgccctggaatccgtgcctcttaatttaccagaaagtctgcgtataattcat
cttcagggtaacaacataacttcaattacagatgacacattctgcaaggctaatgacacc
agttatattcgggatcacattgaagagatacgcttggaagataatcccatcatcctggga
aaatatcccaacagttttatctgcttaaaaagactgcctatagggtcatacatctag

DBGET integrated database retrieval system