KEGG   Sus scrofa (pig): 106510592Help
Entry
106510592         CDS       T01009                                 

Gene name
ZNF470
Definition
(RefSeq) zinc finger protein 470 isoform X2
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106510592 (ZNF470)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    106510592 (ZNF470)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    106510592 (ZNF470)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf_UBZ zf-C2H2_6 zinc_ribbon_15 Zn_ribbon_recom zf-C2H2_11 C1_4 DUF3268 XPA_N Zn_ribbon_SprT DUF4934 zf-BED zf-C2HC_2
Motif
Other DBs
NCBI-GeneID: 106510592
NCBI-ProteinID: XP_005664959
UniProt: I3LU48 A0A4X1SW24
Position
6
AA seq 542 aa AA seqDB search
MATQLLSDGALESVTFRDVTVDFTREEWRQLKPAQKDLYRDVMLENLRNLVSLDLETRPE
MKEPDPKEEISGDKPSVEVVAEGHAGSAGWGSATDAARTQGGGVETPRGNARTWPRRPAA
SRGMASECSEWQAFAHQRPPLGSPRPEDPGEAGAHPSAMRGKTPARNSDLGTPSRPDVEK
KSYDCSECGKAFGRSSSLMKHQRIHSGEKPFQCDVCGKHFLERSSLTIHQRVHTGEKPYA
CGDCGKAFSQRMNLIVHQRTHTGEKPYACGVCGKAFRKTSSLAQHERVHTGEKPYACGDC
GKAFSQNMHLIVHQRTHTGEKPYVCGDCGRAFSQNMHLTEHRRTHTGEKPYACGDCGRAF
NKSSSLTLHRRNHTGEKPYACGECGKAFSQSSYLIQHQRLHIGVKPFECGQCGKAFSKNS
ALTQHQRIHTGEKPYACYICKKHFTGRSSLLVHQMGHTGEKPYACSECGKAFSQSAYLIE
HQRIHTGEKPYRCAQCGKAFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRI
HT
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccacccagctgctgagtgacggggccctggagtcagtgacgttccgggatgtgaca
gtggacttcacgcgggaggagtggcggcagctgaagcctgcccagaaggacctgtacaga
gacgtgatgctggagaacctgcggaacctggtctcgctggacttggaaactagacctgaa
atgaaagaaccggacccaaaggaggagatttccggagacaaaccatcggtggaggtggtc
gcggaaggacacgcagggagtgctggctggggttccgccaccgatgccgcgcggacgcag
ggaggcggggtggagacgccgcggggaaacgctaggacttggccccggcggccggcagcc
tcccgggggatggcctccgagtgtagcgaatggcaggccttcgctcaccagcggcccccc
ctgggctccccccggccggaggatccgggagaagcgggggcgcacccgtctgccatgcgg
ggaaagacccccgcgaggaactcggacctcgggacaccctccagaccggacgtggagaag
aaatcctacgactgcagcgagtgtggcaaggctttcggccgcagctcgtcgctgatgaag
caccagcgcatccacagcggggagaagcccttccagtgtgacgtgtgcggaaagcacttc
ctggagcggtcgtctctgaccatccaccagcgggtccacacgggcgagaagccctacgcg
tgcggggactgcggcaaggccttcagccagcgcatgaacctgatcgtgcaccagcgcacg
cacaccggcgagaagccgtacgcctgcggcgtgtgcgggaaggccttccggaagacctcg
tccctggcccagcacgagagggtgcacacgggcgagaagccctacgcctgcggggactgc
ggcaaggccttcagccagaacatgcacctgatcgtgcaccagcgcacgcacaccggcgag
aagccctacgtgtgcggggactgcggccgcgccttcagccagaacatgcacctgacggag
caccggcgcacgcacacgggcgagaagccgtacgcgtgcggggactgcggccgcgccttc
aacaagagctcgtcgctgacgctgcaccggcgcaaccacacgggcgagaagccctacgcg
tgcggcgagtgcggcaaggccttcagccagagctcctacctcatccagcaccagcggctg
cacatcggcgtgaagcccttcgagtgcggccagtgcggcaaggccttcagcaagaactcc
gccctgacgcagcaccagaggatccacaccggcgagaagccctacgcctgctacatctgc
aagaagcacttcacgggccggtcgtccctgctggtgcaccagatgggccacacgggcgag
aagccctacgcctgcagcgagtgcgggaaggccttcagccagagcgcctacctcatcgag
caccagcgcatccacacgggcgagaagccgtaccggtgcgcgcagtgcgggaaggccttc
atcaagaactcctcgctcacggtgcaccagaggatccacaccggggagaagccctaccgg
tgcggcgagtgtgggaaaaccttcagccggaacaccaacctcacgcggcacctgaggatc
cacacctag

DBGET integrated database retrieval system