KEGG   Sus scrofa (pig): 396619Help
Entry
396619            CDS       T01009                                 

Gene name
ST3GAL3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00514  Other types of O-glycan biosynthesis
ssc00515  Mannose type O-glycan biosynthesis
ssc00533  Glycosaminoglycan biosynthesis - keratan sulfate
ssc00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    396619 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    396619 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    396619 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    396619 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    396619 (ST3GAL3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     396619 (ST3GAL3)
Glycosyltransferases [BR:ssc01003]
 Terminal extension
  Sialyltransferase
   396619 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 396619
NCBI-ProteinID: NP_998924
UniProt: Q70D54
Position
6
AA seq 374 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSVVLSFDSAGQTLGSEYDRLG
FLLKLDSKLPAELATKYANFSEGACKPGYASAVMTAIFPRFSKPAPMFLDDSFRKWARIR
EFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLSCRRCIIVGNGGVLANKSLGSRIDDY
DIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKY
IVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPT
LGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLQK
LVKARVITDLTSGI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtacgcaatctgctgctagccctctgcctttttctggtgttg
ggatttttgtattattctgcgtggaagctacatttactccagtgggaggactccaattca
gtggttctttcctttgactccgctggacaaacgctaggctcagagtatgaccggttgggc
tttctcctgaagctggactctaaactgcctgctgagttggccaccaagtacgcaaacttt
tcagaaggagcttgcaagcctggctatgcgtcagccgtgatgactgccatcttcccccgg
ttctccaaaccagcacccatgttcctggatgactccttccgaaagtgggccaggatccgg
gaatttgtgccgccttttgggatcaaaggtcaagacaatctgatcaaagccatcctgtcc
gtcaccaaagagtaccgcctgaccccggccttggacagcctcagctgccgccgctgcatc
atcgtgggcaacggaggtgtcctcgccaacaagtctctggggtcacgaattgatgactat
gacattgtggtcagactgaactcggcgccagtgaaaggcttcgagaaggacgtgggcagc
aaaaccacactacgcatcacctaccccgagggcgccatgcagcggcccgagcaatacgaa
cgcgattctctcttcgtcctcgctggcttcaagtggcaggacttcaagtggctgaagtac
atcgtctacaaggagcgagtgagtgcatcggacggcttctggaaatcggtggccactcgc
gtgcccaaggaacccccagagattcgcatcctcaatccatatttcatccaggaagccgcc
ttcaccctcatcggactgcctttcaacaatggcctcatgggccgagggaacatcccgacc
ctcggcagtgtggccgtgaccatggcactgcacggctgcgatgaggtggccgtcgccggc
ttcggctacgacatgagcacacccaatgcacccctgcactactacgagaccgtgcgcatg
gcagccatcaaagagtcctggacgcacaacatccagcgagagaaagagtttctgcagaag
ctggtcaaagcacgcgtcatcactgacctgaccagcggcatctga

DBGET integrated database retrieval system