KEGG   Sus scrofa (pig): 396629Help
Entry
396629            CDS       T01009                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04120  Ubiquitin mediated proteolysis
ssc04140  Autophagy - animal
ssc04144  Endocytosis
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc05133  Pertussis
ssc05140  Leishmaniasis
ssc05142  Chagas disease (American trypanosomiasis)
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05162  Measles
ssc05168  Herpes simplex infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05222  Small cell lung cancer
Module
ssc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    396629 (TRAF6)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    396629 (TRAF6)
   04064 NF-kappa B signaling pathway
    396629 (TRAF6)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    396629 (TRAF6)
   04140 Autophagy - animal
    396629 (TRAF6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    396629 (TRAF6)
   04621 NOD-like receptor signaling pathway
    396629 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    396629 (TRAF6)
   04657 IL-17 signaling pathway
    396629 (TRAF6)
  Nervous system
   04722 Neurotrophin signaling pathway
    396629 (TRAF6)
  Development
   04380 Osteoclast differentiation
    396629 (TRAF6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    396629 (TRAF6)
   05222 Small cell lung cancer
    396629 (TRAF6)
  Infectious diseases
   05133 Pertussis
    396629 (TRAF6)
   05152 Tuberculosis
    396629 (TRAF6)
   05162 Measles
    396629 (TRAF6)
   05160 Hepatitis C
    396629 (TRAF6)
   05168 Herpes simplex infection
    396629 (TRAF6)
   05169 Epstein-Barr virus infection
    396629 (TRAF6)
   05145 Toxoplasmosis
    396629 (TRAF6)
   05140 Leishmaniasis
    396629 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    396629 (TRAF6)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     396629 (TRAF6)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    396629 (TRAF6)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    396629 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Tropomyosin_1 Spc29 DUF3450 U-box IncA Med21 DUF4455 DUF16 EzrA TACC Sina HMMR_N ADIP TMF_DNA_bd Myosin_tail_1 PspA_IM30 DUF1664 CENP-F_leu_zip
Motif
Other DBs
NCBI-GeneID: 396629
NCBI-ProteinID: NP_001098756
Ensembl: ENSSSCG00000013291
Vega: OTTSUSG00000002873
UniProt: A7XUJ6
Position
2
AA seq 541 aa AA seqDB search
MSLLHCENSCGSSQSESDCCAAMAASSCGAAAKDDGVSGTASTGNLSSSFMEEIQGYDVE
FDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFP
DNFAKREILSLTVKCPNVGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLNIHIL
KECPRRQVSCVNCAVSMAFEDKEIHDQNCPLANVICEYCNTVLIREQMPNHYDLDCPTAP
VPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMMAQALQGLSLAVAPVPQRDMLPYDSSP
LSRISSGCCSDQNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRSLEDKV
AEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLDALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSG
T
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctacattgtgaaaacagctgtggatccagccagtctgagagcgactgctgt
gctgccatggctgccagctcctgtggtgctgcagcgaaagatgacggtgtgagtggaact
gccagcacagggaatctctccagctcttttatggaagagatccagggatatgatgtggag
tttgacccacccctggaaagcaaatatgagtgccccatctgcttgatggcgttacgggaa
gcagtgcagaccccctgtggtcataggttctgcaaagcctgcatcatcaagtcaataagg
gatgcaggtcacaaatgtccagttgacaatgaaatactgctagaaaatcaactattccct
gacaattttgcaaaacgagagattctttctctgacggtgaagtgtccaaatgtaggttgt
ttgcacaagatggaactgaggcatcttgaggatcatcaagcacattgtgaatttgctctt
atgaattgtccccagtgccaacgtcccttccaaaaatgccaacttaatattcacattctc
aaggagtgtccgaggagacaggtttcttgtgtaaactgtgctgtatctatggcatttgaa
gataaagagattcatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaat
acggtgctcatcagagaacagatgcccaatcattatgacctggactgtcctacagcccca
gttccatgcacattcagtacttttggctgccatgaaaagatgcagaggaatcacttggca
cgccacctgcaagagaatacccagtcgcacatgagaatgatggcccaggctcttcagggt
ttaagcctcgcagtagctcctgtacctcagcgtgatatgcttccctatgattcttcccct
ttgtctcggatttcctctggctgttgctcagaccagaatttccaggaaaccattcagcag
ttagaaggtcgccttgtaagacaggaccatcaaatccgggagctaactgcgaaaatggaa
actcagagcatgtacgtaagtgagctcaaacgaactattcgaagccttgaggacaaagtt
gcagaaatagaggcacagcagtgcaatgggatttacatctggaagattggcaactttggg
atgcacttgaaatctcaagaggaggagaaacctgttgtcattcacagtcctggattctac
acaggcaaacctggctacaaactgtgcatgcgtctgcacctgcagctgcccacggcacag
cgctgtgccaactacatatccctctttgtccacaccatgcaaggagagtatgacagccac
ctcccttggcccttccagggaacgatacgccttacaatcctcgaccagtctgaagcgcct
atcaggcaaaaccatgaagagataatggatgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaaccccaaaggttttggctatgtgacttttatgcatctggacgcc
ctaagacagagaaccttcatcaaggatgacactctattagtacgctgtgaggtctccacc
cgcttcgacatgggtagtcttcggagggagggttttcagccacgaagtacagactcgggg
acatag

DBGET integrated database retrieval system