KEGG   Sus scrofa (pig): 396668
Entry
396668            CDS       T01009                                 

Gene name
CCL4
Definition
(RefSeq) C-C motif chemokine 4 precursor
  KO
K12964  C-C motif chemokine 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04061  Viral protein interaction with cytokine and cytokine receptor
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04620  Toll-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    396668 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396668 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    396668 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    396668 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    396668 (CCL4)
   04062 Chemokine signaling pathway
    396668 (CCL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    396668 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    396668 (CCL4)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Chemokines
   396668 (CCL4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 396668
NCBI-ProteinID: NP_998944
Ensembl: ENSSSCG00000017698
Vega: OTTSUSG00000002867
UniProt: Q711P4 B0FYJ9
Position
12
AA seq 92 aa
MKLCVTVLSLLVLVAAFCSPALSAPMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQ
PAVVFQTKKGRQVCANPSDDWVQEYMDDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctctccctcctggtcctggtcgctgccttctgctctcca
gcgctctcagcaccaatgggctcagaccctcccacctcctgctgcttcacatacaccgtg
cggaagcttcctcgcaacttcgtgactgattactatgagaccagcagcctctgctcccag
ccagccgtggtattccagaccaaaaagggcaggcaggtctgcgccaaccccagtgatgac
tgggtccaggagtacatggatgacttggaactgaactga

DBGET integrated database retrieval system