KEGG   Sus scrofa (pig): 396673Help
Entry
396673            CDS       T01009                                 

Gene name
PGK2
Definition
(RefSeq) phosphoglycerate kinase 2
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc01230  Biosynthesis of amino acids
Module
ssc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssc_M00002  Glycolysis, core module involving three-carbon compounds
ssc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    396673 (PGK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    396673 (PGK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     396673 (PGK2)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   396673 (PGK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGK IMPa_helical
Motif
Other DBs
NCBI-GeneID: 396673
NCBI-ProteinID: NP_998947
UniProt: Q6RI85 X4ZHK0
Position
7
AA seq 417 aa AA seqDB search
MSLSKKLTLDKLDVKGKRVIMRVDFNVPMKRNQVTNNQRIKASLPSIRYCLDNGARSVVL
MSHLGRPDGVAMPDKYSLEPVAAELKSLLGKDVLFLKDCVGSEAEQACANPPAGSVILLE
NLRFHVEEEGKGQDPSGNKLKAEPDKVEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKASGFLMKKELDYFAKALENPERPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGASLFDKEGATIVKEIMAKAEKNRVNITFPVDFVIADKFEENAKVGQ
ATVASGIPAGWVALDCGPETNKKYAQVVARAKLIVWNGPLGVFEWDAFANGTKALMDEIV
KATSKGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVEALSNL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttctaagaagttaactttggacaaactggacgtgaaagggaaacgagtcatc
atgagagtagacttcaatgttcccatgaagaggaaccaagttacaaacaaccaaagaatc
aaggcttccctcccaagcatcagatactgcctagataacggagccaggtcagtagttctc
atgagtcatttaggtagacctgatggtgttgcgatgcctgataaatactccttagagccg
gtggctgctgaactcaaatccttgctggggaaagacgttctgttcctaaaagactgtgtg
ggctcagaagcagagcaagcttgtgccaacccacctgcgggttcagtcatcctactggag
aaccttcgctttcatgtggaagaggaagggaagggccaagatccttctgggaataagctg
aaagctgagccagataaagtagaagccttccgcgcatcgctctccaagctgggggatgtg
tatgtcaatgatgcttttggcacggctcaccgggctcacagttccatggtgggagtgaat
ctgccgcagaaggcatctggattcctgatgaaaaaggagctggattactttgccaaagcc
ttggaaaacccagagagaccctttctggctatccttggtggagctaaagtggcagacaag
atccaactcatcaaaaatatgctggacaaagtcaatgagatgattattggtggcggaatg
gcctttaccttccttaaggtactcaacaacatggagattggtgcctccctgttcgacaaa
gagggagccacgattgtcaaagagatcatggccaaagctgaaaagaatagggtgaacatt
acctttcctgttgactttgtcattgctgacaagtttgaggaaaatgctaaggttggccag
gccacggtagcgtcaggtatacctgccggctgggtggctttggactgtggtcctgagacc
aacaagaagtatgcacaagttgtggcccgagccaagctaattgtgtggaatggaccttta
ggggtctttgaatgggatgcctttgctaatggaacgaaagccctcatggatgaaattgtg
aaagccacctccaagggctgtatcactattataggaggtggagacacggccacttgctgt
gccaaatggaacactgaagataaagtcagtcatgtgagcactggaggaggtgccagtcta
gagcttctggaaggtaaagtccttcctggagtggaggctctcagcaatctgtag

DBGET integrated database retrieval system