KEGG   Sus scrofa (pig): 396699
Entry
396699            CDS       T01009                                 

Gene name
RSC1A1
Definition
(RefSeq) regulatory solute carrier protein family 1 member 1
Organism
ssc  Sus scrofa (pig)
SSDB
Other DBs
NCBI-GeneID: 396699
NCBI-ProteinID: NP_998958
Ensembl: ENSSSCG00000003461
UniProt: Q29106
Position
6
AA seq 623 aa
MSSLPTSDGFNHQAHPSGQRPEIGSPPSLAHSVSASVCPFKPSDPDSIEPKAVKAVKALK
ASAEFQITFERKEQLPLQDPSDCASSADNAPANQTPAIPLQNSLKEAIVADNLEKSAEGS
TQGLKSHLHTRQEASLSVTTTRMQEPQRLIGEKGWHPEYQDPSQVNGLQQHEEPRNEQHE
VVQQNAPHDPEHLCNTGDLELLGERQQNQPKSVGLETAVRGDRPQQDVDLPGTEKNILPY
GCFGCSSSETFMEIDTVEQSLVAVLNSAGGQNTSVRNISASDLTVDNPLMEVETLKCNPS
SEFLSNPTSTQNLQLPESSVEMSGTNKEYGNHPSSLSLCGTCQPSVESAEESCSSITAAL
KELHELLVISSKPALENTSEEVTCRSEIVTEGQTDVKDLSERWTQSEHLTAAQNEQCSQV
SFYQATSVSVKTEELTDTSTDAGTEDVENITSSGPGDGLLVDKENVPRSRESVNESSLVT
LDSAKTSNQPHCTLGVEISPGLLAGEEGALNQTSEQTESLSSSFILVKDLGQGTQNPVTN
RPETRENVCPEAAGLRQEFEPPTSHPSSSPSFLAPLIFPAADIDRILRAGFTLQEALGAL
HRVGGNADLALLVLLAKNIVVPT
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgtcatcattaccaacttcagatggctttaaccatcaagcccatccttcaggacagaga
cctgagattggtagtcctccaagtcttgctcactctgtctctgcctcagtctgccctttc
aagcccagtgacccagacagcattgaacctaaagctgtgaaggctgtgaaggctttgaag
gcttcagctgaattccagataacctttgaaaggaaagaacagcttcctctccaggatcct
tctgattgtgcttcttcagcagacaatgctccagcaaaccagactccagctatccctttg
cagaattccctcaaagaagccattgttgcagataatctagagaaatctgctgaaggaagc
acccaaggcctcaaatctcatctccacacaagacaggaagctagtttatctgtcacaact
actaggatgcaagagccacagaggcttataggtgaaaagggttggcatcccgaatatcag
gacccaagtcaagtgaatggccttcagcagcacgaagaaccaaggaatgaacagcatgag
gttgtacagcagaacgctccgcatgacccagaacatctgtgtaacacaggggacttggaa
cttcttggagaaaggcaacagaatcaaccaaaaagtgttggtttggaaactgcagtgaga
ggagacaggccgcagcaggatgtggaccttcctggtacagagaaaaatattctcccttac
ggatgctttggctgctcaagttcagaaacatttatggaaatagatacagttgaacagtcc
ctagttgctgtgcttaattcagcaggcggtcagaatacctctgtcaggaacatcagtgca
tctgatctcaccgtagataatcccttaatggaagtagaaacattgaaatgtaatccttcc
tctgaatttttgagtaatcccacttccactcagaatttacagcttccagaaagtagtgtt
gaaatgtctggaacaaataaagaatatgggaatcacccctcctctttaagtctctgtggc
acttgtcagccctctgtagagtcagcagaggaatcttgctcatctataacggcagccttg
aaggaacttcatgagcttttggtcattagtagtaaaccagcgttagaaaatacatctgaa
gaagttacctgtcggtcagagatagtaactgagggccaaacagatgttaaggacctttct
gaaagatggacccaaagtgagcatcttacagctgctcagaatgagcagtgttcacaagtc
tccttctatcaggccacatctgtatcagtgaagacagaagaattaacagacacttcaact
gatgctggaacagaagatgtagaaaatattacctccagcggtccaggtgatggcctgtta
gtggataaggaaaatgtccccaggtctagggaatcagtaaacgagagcagtttagtcact
ctagactcagctaaaacgtctaatcaaccacactgcaccttaggtgtagaaatttcaccc
ggacttttagcaggtgaggagggtgcactcaaccagacttctgagcaaacggagtccttg
tcatccagcttcatactggttaaagatttgggtcagggcacacagaatccagtgacaaac
aggcctgagaccagagaaaatgtctgtcctgaagctgcagggctacgtcaagaatttgaa
ccacctaccagccatccatcatcaagtccttcctttcttgcaccgttaatttttcctgct
gcagacattgaccggattcttcgggccggctttaccttgcaggaagctcttggggctttg
catcgagttggtggaaatgcagaccttgcacttcttgttttgctagcaaagaacattgta
gttcctacataa

DBGET integrated database retrieval system