KEGG   Sus scrofa (pig): 396703Help
Entry
396703            CDS       T01009                                 

Gene name
SON
Definition
(RefSeq) protein SON isoform X2
  KO
K23718  protein SON
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ssc03041]
    396703 (SON)
Spliceosome [BR:ssc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR-related proteins
    396703 (SON)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-patch RSRP DND1_DSRM G-patch_2 dsrm
Motif
Other DBs
NCBI-GeneID: 396703
NCBI-ProteinID: XP_003358980
Ensembl: ENSSSCG00000023674
UniProt: A0A287BK71
Position
13
AA seq 2414 aa AA seqDB search
MATNIEQIFRSFVVSKFREIQQELSSGRSEGQLNGETNTPIEGNQAGDAAASARTLPNEE
IVQKIEEVLSGVLDTELRYKPDLKEASRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKK
KKKEKEKKYKKQPEESESKMKSHHDGNIDLESDSFLKFDSEPSAMALEHPLRVFGNSESP
AVVLESPIVSMEVSEPHTLETLKPATKTAELSVASTSVVSVQSEQSVEVMLEPSTTKILD
SFATAPVSTTTVVLKSSEPVVTMSVEYQMKSVLNTPPEPSKMLLEPPVAKVLEPSETLVS
SETPTEVHPEPSTSTTVDFPESSATEVLRLPEQPVEVPSENADSSMTRPQEMLELPKTTA
LELQESSVASATELPGPPATSMPELQGPPVTPVLELPGPSATPVSELPGPLSTPVPELLG
PPATAVPELPGPSVTSVPQLSQELPGLPAPSVGLEPPQEVPEPPVMAQELPGLPAVTAAV
ELPGQPVVTVAMELTEQPVTTTELEHPVGMTTVEHPGQPEVTTATGLLGQPEAAMVLEFP
GQPVATTALELPGQPSVTGVPELPGLPSATRALELSGQPVATGALELPGQLMATGALEFS
GQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVTTTELSTMTV
SQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAQESHMLASNTMETHMLASN
TMDSQMLASNTMDSQMLASNTMDSQMLASSTMDSQMLATSSMDSQMLATSSMDSQMLATS
SMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSTMDSQMLATS
SMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGSK
SPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTPDPYRMSPRP
YRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSYERSMMSPMA
ERSMMSAYERSMMSAYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMADRSMMSMGAD
RSMMSSYSAADRSMMSSYSAADRSMMSSYTADRSMMSMAADSYTDSYTDTYTEAYMVPPL
PPEEPPTMPPLPPEEPPMTPPLPPEEPPEGSALPTEQSALAAENTWPIEVPALPPEESVS
LPEPPVSQSEVSEPSAVPANYSVSASEPSALASEAAVTVPEPPLEPESSVTSTPVESAAV
VEHEIVPERPVTYMVSETPMMSAEPTMLTSESETAETFDSMRASGHADSEISVSLLEPAV
PIPEPSQSTLGLPAMAVSELPAVAVPEQSAGTVAEPPAMAVTEPLAVAAPDPPAVAVQDP
PAEAVPEPLALSEPEHVTIPVPVVSALEPTVPILEPAVSVLQPNLIVSEPSISVQDPTVT
ISEPPVTVSEQTQVIPTEMVLESTPVILESSATKGMNLLSGDQNLAPEMGMQEIPMHSEE
EPHAEGHLKNDCYETENGMSTDLNINNHLIAKEMEHNTVSAASIGAVGEMGEEKILPTHE
TKQCTVLDTCSSVSETDVGGTLSSTGPLALEPDAVGAGKGIEFATASALSSISKYDVEGA
LTTQDTEHDMVISTSPSGGSEADIEGPLLAKDIHLDLSSNSNFISKDAEESLPIQESDQT
LAVALSPKETSGEDKEVPLPATEAVSDTGFPANIDDINEADLVRPLLPKDMERLTSLRAG
IEGPLLSSEVERDKSAASPVVISIPERASESSSEEKDDYEIFVKVKDTHEKSKKNKNRDK
GEKEKKRDSSLRSRSKRSKSSEHKSRKRTSESRSRARKRSSKSKSHRSQTRSRSRSRRRR
RSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTGRARSRTPSRRSRS
HTPSRRRRSRSGGRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRSRTPSRRS
RTPSRRRRSRSVVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRSSERGRSPKRLTD
LNKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGATIEELTEKCKQI
AQSKEDDDVIVNKPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLNIAAAKPTPPKSQVTLT
KEFPVSSGSQHRKKEADSVYGEWVPVEKNGEENKDDDNVFSSSLPSEPVDISTAMSERAL
AQKRLSENAFDLEAMSMLNRAQERIDAWAQLNSIPGQFTGSTGVQVLTQEQLANTGAQAW
IKKDQFLRAAPVTGGMGAVLMRKMGWREGEGLGKNKEGNKEPILVDFKTDRKGLVAVGER
AQKRSGNFSAAMKDLSGKHPVSALMEICNKRRWQPPEFLLVHDSGPDHRKHFLFRVLRNG
SPYQPNCMFFLNRY
NT seq 7245 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaacatcgagcagatttttaggtctttcgtggtcagtaaattccgggaaatt
caacaggaactttcaagtggaaggagtgaaggccagctcaatggtgaaacaaatacacct
attgaaggaaaccaggcaggtgatgcagctgcctctgccaggaccctaccaaatgaagaa
atagttcagaagatagaggaagtactttctggggtcttagatacagaactgcgatataag
ccagacttgaaggaggcctccagaaaaagtagatgtgtgtctgtacaaacagatcctact
gatgaaattcctaccaaaaagtcgaagaagcataaaaagcacaaaaataaaaagaagaaa
aagaagaaagaaaaagaaaaaaagtataaaaaacagccggaagaatctgaatcaaagatg
aaatcacatcatgatgggaacatagatttagaatcggattcctttttgaagttcgattct
gaaccttcagcgatggcactggagcatcctttaagagtgtttggcaacagtgaatctcct
gcagttgtgctagaatctcctatagtatcaatggaggtatcagagccacacaccctagaa
actctgaaaccagctacaaaaactgcagaactgtcagttgcatctacatcagtagtctcg
gtgcagtcagagcagtctgtggaagtaatgctggaaccatccacaacaaagatcctggat
tcctttgcaacagcaccagtgtctactacaacagtagtcctaaagtcatctgagccagtt
gtaacaatgtcagtggagtatcagatgaagtctgtgctgaacacacctccagaaccatca
aagatgttgttagagcctccagtagcaaaagtgctagagccatcagaaacccttgtatca
tcagagacacctaccgaggtgcatcctgagccaagcacatcaaccacagtagattttcca
gagtcatcagcgactgaagtgctaagattgccagagcagcctgtagaagtaccctcggag
aatgcagattcatccatgacaagaccacaggagatgctggagctgcccaagaccacagcg
ttggagctgcaggagtcgtcggtggcctcagcgacggagttgccggggccacctgcgacc
tccatgccggagttgcaggggccccctgtgactccagtgctggagttacccgggccctct
gctaccccggtgtcggagttgccagggcccctttctaccccagtgcctgagttgctaggg
ccccctgcgacagcagtgcctgagttgcccgggccctctgtgacatcagtgccacagttg
tcgcaggaattgccagggcttccagcaccatctgtggggttggagccaccacaggaggta
ccagagccacctgtgatggcacaggagttgccaggcctccctgcagtgacagctgcagta
gagttgccagggcaacctgtggtaacagtagcaatggagttgaccgaacaacctgtgacg
acaacagagttggagcaccctgtggggatgacaacggtggaacatcctgggcaacctgag
gtgacgacggcaacagggttgctggggcagcctgaggcagcaatggtgctggagtttcca
ggacagccagtggcaacaacagcgctggagttgccagggcagccttcggtgactggggtg
ccagagttgccagggctgccttcggcaactagggcactggagttgtcagggcagcctgtg
gcgactggggcactggagttgcctgggcagctcatggcaactggggcactggagttctcg
gggcaatctggggcagctggagcactggagcttttggggcagcctttggcaacaggggtg
cttgagttgccagggcagcctggggcgccagagttgcccgggcagcctgtggcaactgtg
gcgctggagatctctgttcagtctgtggtgacaacaacggagctgtcaacgatgaccgtg
tcgcagtccctggaggtgccctcgacgacagcgctggagtcctataatacggtagcacag
gagctgcctactacattagtgggggagacttctgtaacagtaggagtggatcccctgatg
gcccaagaatcccatatgttagcttctaacaccatggagacccatatgttagcatccaac
accatggactcccagatgctagcttccaacaccatggactcccagatgctagcatccaac
accatggactcccagatgttagcctctagcaccatggactcccagatgttagcgaccagc
tccatggactcccagatgttagcgaccagctccatggactcccagatgttagcgaccagc
tccatggactcccagatgttagcgaccagctccatggactcccagatgttagcgaccagc
tccatggactcccagatgttagcgaccagctccatggactcccagatgttagcgaccagc
tccatggactcccagatgttagcgaccagcactatggactcccagatgttagcgaccagc
tccatggactcccagatgttagcgactagctctatggattcccagatgttagcatctggc
actatggactctcagatgttagcttccggcaccatggatgctcaaatgttagcgtctggt
accatggatgcccagatgttagcatctagtacccaagattctgctatgctgggttcaaaa
tctcctgatccctacaggttagctcaggatccttacaggttagctcaggatccctatagg
ttaggtcatgacccttataggctaggtcatgatgcctacaggttagggcaggacccttat
agattaggccatgatccctacagactaactcctgatccctataggatgtcacctagaccc
tataggatagcacccaggtcctatagaatagcccccaggccatataggttagcacctaga
cccctgatgttagcatctagacgttctatgatgatgtcctatgctgcagaacgttccatg
atgtcatcttacgaacgctctatgatgtcctatgaacgatctatgatgtcccctatggct
gagcgctctatgatgtcagcctatgagcgctctatgatgtcagcttatgagcgctctatg
atgtcccctatggctgagcgttctatgatgtcagcttatgaacgctctatgatgtcagct
tacgagcgctccatgatgtccccaatggctgaccgatctatgatgtccatgggtgctgac
cggtctatgatgtcgtcatactctgctgctgaccggtctatgatgtcatcgtactctgca
gctgaccggtctatgatgtcatcttatactgctgatcgttcaatgatgtctatggcagct
gattcttacaccgattcttatactgatacatatacggaggcatacatggtgccacctttg
cctcctgaagagcctccgacaatgccaccattgccacctgaagagccaccaatgacacca
ccattgcctcctgaggaaccaccagaaggttcagcattacccactgagcagtcagcattg
gcagctgaaaatacttggcctatcgaggtgccagcattacctcctgaagagtctgtatcg
ctgcctgaacctcctgtgagtcaaagtgaggtttcagagccttcggcagtgcctgctaat
tactcagtgtcagcatcggagccttcagcgttagcatcagaggctgctgtgactgttcca
gaaccaccactagaaccagagtcttcggttacatcaacacctgtagagtctgctgctgta
gtagagcatgaaattgttccagagagaccagtgacttatatggtgtctgaaactcccatg
atgtcagctgaaccgactatgttaacttcagagtcagagacagcagaaacttttgattcc
atgagagcttcaggacatgctgactcagagatatctgtgtccctgctggagccagcagta
cctattccagagccatcacagagcactctaggtctcccagctatggctgtctcagagctg
ccagctgtggctgtccctgagcaatcagctgggactgttgcagagccaccagccatggct
gtcacagagcccctggctgtggctgccccagacccacctgctgtggctgtccaggaccca
ccagctgaggctgtcccagagcccctggccttgtctgagccagagcatgttaccattcct
gtgccagttgtttctgccctggagcctactgtgcctatcctggaaccagcggtgtccgtc
cttcaacctaacttgatcgtttcagaaccatctatttctgtccaagaccccactgtgaca
atttcagagcctcctgtcactgtttcagagcagacacaagtaataccaactgagatggtt
ttagagtctacaccagtaatcctggagtctagtgctacgaaaggaatgaatttactatct
ggtgatcaaaatcttgctccagagatgggcatgcaggagattcccatgcattcagaggaa
gagccacatgccgaaggacacctgaagaatgactgttatgaaactgaaaatggtatgagt
acagaccttaatataaataatcacttaattgctaaagagatggaacataacacagtgtcc
gctgccagcattggtgctgttggtgaaatgggtgaagagaaaattttgcccacccatgag
actaaacaatgcacagtattggatacctgctctagtgttagtgaaactgatgtaggagga
actctgtcttctactggtccccttgctcttgaacctgatgcagtgggagctggtaagggt
attgaatttgccacagcatctgctctcagttcaattagtaaatatgatgttgaaggagct
ttaactactcaagatactgaacatgatatggtaatttctaccagccccagtggtggtagt
gaagctgacatagagggacctttgcttgctaaagacattcatcttgacttatcatctaat
agtaactttattagtaaggatgcagaggaatcattacctatacaggaaagtgaccagaca
ttagcagttgctcttagtcctaaagaaactagtggagaagataaagaagtacctctccct
gctacagaggcagtgtctgatacaggatttcctgccaatattgacgacattaatgaagct
gatttagtgcgaccattacttcctaaggacatggaacgtcttaccagccttagagctggt
attgaaggacctttactttcaagtgaagttgagcgggataaatctgctgccagtccagtt
gtaattagcataccagaaagagcctcagagtcgtcttcagaggaaaaagatgattatgaa
atttttgtaaaagttaaggacacacatgaaaaaagcaagaaaaataagaaccgagacaaa
ggcgagaaagagaagaaaagagactcttcattaagatctcgaagtaagcgttccaagtct
tctgaacacaaatcacgaaagcgcaccagtgaatctcgttctagggcaaggaagagatca
tctaagtccaagtctcatcgctctcaaactcgttcacggtcccgatcaagacgacggagg
aggagcagcaggtcaaggtcaaagtccagaggaaggcgctctgtgtcaaaagagaagcgc
aaaagatctccaaagcacaggtccaagtccagggaaagaaaaagaaaaagatcaagctcc
agggataatcggaaaacaggtagagctcgaagtcgcaccccaagtcgacggagccggagt
cacactccgagtcgtcgaagaagatctagatctgggggaagaaggagctttagcatttcc
ccgagccgacggagccgtacccccagccgacggagccgtacccccagccgacggagccgc
acccccagccgacggagccgcactcccagccgtcggagccgcaccccaagtcgacggagc
cgcacccctagccgtcggagaagatcaaggtctgtggtaagaagacgaagcttcagtata
tcaccagtcagattaaggcgatcacgaacacctttgagaagaaggtttagcagatctccc
atccgtcgtaaacgatccaggtcttctgaaagaggcagatcacctaaacgcctgacagat
ttgaataaggctcagttacttgaaatagccaaagctaatgcagctgccatgtgtgctaag
gctggtgttcctttaccgccaaacttaaagcctgcacctccacctacaatagaagaaaaa
gttgctaaaaagtcaggaggagcaactatagaagaactaactgagaaatgcaaacagatc
gcacagagtaaagaagatgatgatgtgatagtgaataagcctcatgtttcggatgaagag
gaagaagaacctcctttttatcatcatccctttaaactcagtgaacccaaacctattttt
ttcaatcttaatattgcagcggcaaagccaactccaccaaaaagccaggtaacattaaca
aaagaattccctgtgtcatctggatctcagcatcgaaaaaaggaagcagatagtgtttat
ggagaatgggttcctgtagagaaaaacggtgaagaaaacaaagatgatgataatgttttc
agcagcagtttgccctctgagcctgtggacatctctacagcaatgagtgagcgggcactt
gctcagaaaagactcagcgagaatgcatttgaccttgaagcgatgagcatgttaaatcgt
gctcaggaacggatcgatgcctgggctcagctgaactctattcccggccagttcacagga
agtacaggagtacaggttctgacacaagaacagttggccaataccggggcccaagcctgg
attaaaaaggatcaattcttaagagcagccccagtaactggaggaatgggagcggttttg
atgagaaaaatgggctggagagaaggagaaggattaggaaaaaacaaagaaggaaataag
gaacctatcctagttgactttaaaacagaccgaaaaggtcttgttgcagtaggagaaaga
gcacaaaagaggtctggaaacttctctgctgccatgaaagatctgtcaggcaaacatcct
gtgtctgccttgatggaaatctgtaataagagaaggtggcaaccacctgaatttcttctg
gtccatgatagtggccctgatcatcgcaaacattttctctttagggtattgagaaatgga
agcccttaccagcccaattgtatgtttttcttgaataggtattga

DBGET integrated database retrieval system