KEGG   Sus scrofa (pig): 396728
Entry
396728            CDS       T01009                                 

Gene name
GHRL
Definition
(RefSeq) appetite-regulating hormone precursor
  KO
K05254  ghrelin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    396728 (GHRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396728 (GHRL)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    396728 (GHRL)
SSDB
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Other DBs
NCBI-GeneID: 396728
NCBI-ProteinID: NP_998972
Ensembl: ENSSSCG00000011568
UniProt: Q9GKY5 G9M5P1
Position
13
AA seq 118 aa
MPSTGTICSLLLLSVLLMADLAMAGSSFLSPEHQKVQQRKESKKPAAKLKPRALEGWLGP
EDSGEVEGTEDKLEIRFNAPCDVGIKLSGAQSDQHGQPLGKFLQDILWEEVTEAPADK
NT seq 357 nt   +upstreamnt  +downstreamnt
atgccctccacggggaccatttgcagcctgctgctcctcagcgtgctcctcatggcagac
ttggccatggcgggctccagcttcttgagccccgaacaccagaaagtgcagcagagaaag
gagtccaagaagccagcagccaaactgaagccccgggccctggaaggctggctcggccca
gaagacagtggtgaggtggaaggcacggaggacaagctggaaatccggttcaacgccccc
tgtgatgttgggatcaagttgtcaggggctcagtccgaccagcacggccagcccctgggg
aaatttctccaggacatcctctgggaagaggtcactgaggccccggccgacaagtga

DBGET integrated database retrieval system