KEGG   Sus scrofa (pig): 396730Help
Entry
396730            CDS       T01009                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2 precursor
  KO
K05466  angiopoietin 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    396730 (ANGPT2)
   04015 Rap1 signaling pathway
    396730 (ANGPT2)
   04010 MAPK signaling pathway
    396730 (ANGPT2)
   04066 HIF-1 signaling pathway
    396730 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    396730 (ANGPT2)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    396730 (ANGPT2)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   396730 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Spc29
Motif
Other DBs
NCBI-GeneID: 396730
NCBI-ProteinID: NP_998973
Ensembl: ENSSSCG00000015753
UniProt: Q9BDY7
Position
15
AA seq 496 aa AA seqDB search
MWQLVFFALSCDLVLAAAYNNFRKSMDSTGKRQYQVQHGPCSYTFLLPETDNCRSPSSSY
VSNAVQRDAPLDYDDSVRRLQVLENIMENNTQWLMKLESYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLDMEDKHIVQLQSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVN
NSVLQKQQHDLMETVHNLLTMISTSNSAKHSLVAKEEQIIFRDCAEAFKSGLTTSGTYTL
TFPNSTEETKAYCDMETGGGGWTVIQRREDGSVDFQRTWKEYKMGFGSPSGEHWLGNEFV
SQVTNQKRYVLKIHLRDWEGNEAYSLYEHFYLSSEEFNYRIHLKGLTGTAGKISSISQPG
NDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagcttgttttcttcgctctgagctgtgatctcgtcttggctgcagcctataac
aactttcggaagagcatggacagcacggggaagaggcagtatcaggttcagcacggcccc
tgcagctacacgttcctgctgcctgagacggacaactgccgctccccttccagctcctac
gtgtccaacgcggtgcagagggacgcgccgctcgactatgacgactctgtgcggaggctg
caagtgctggagaatatcatggaaaacaatacccagtggctaatgaagcttgagagctac
atccaggacaacatgaagaaagaaatggtggagatacaacagaatgcggtacagaaccag
actgctgtgatgatagaaataggaaccaacctacttaaccaaacggcagagcagacccgg
aagttaactgacgtcgaagcccaagtattaaatcagacaacaagacttgaacttcagctt
ctggaacattctctttctacaaacaaattggaaaaacagattttggatcagaccagtgaa
ataaacaaattgcaagataagaacagtttcctggaaaagaaagttctagatatggaagac
aagcacatagttcaacttcagtcaataaaagaagagaaagatcagctccaggtgttagta
tccaagcaaaattccatcattgaagaactagaaaaacaactggtgactgccacggtgaat
aactcagttctccaaaagcagcaacacgatctgatggagacggttcataatttattgact
atgatatcgacatcaaactcagctaagcactcccttgttgctaaggaagaacaaatcatc
ttcagagactgcgcagaagcattcaaatcaggactaacaaccagcggcacctacacgctg
acctttcctaactccactgaggagaccaaggcttactgcgacatggaaacgggtggaggt
ggatggacagttattcagcgacgtgaagatggaagtgttgattttcagaggacttggaaa
gaatataaaatgggctttgggagtccctcaggcgaacactggctgggaaatgagtttgtg
tcacaagtgaccaatcagaaacgctacgtgcttaagatacacctgagagactgggaaggc
aacgaggcttactcactgtatgaacacttctatctctccagtgaagaattcaattacagg
attcaccttaaaggacttacagggacagccggcaaaataagcagcataagccaaccagga
aatgattttagcacaaaggacgcagacaacgacaaatgtatctgcaaatgttcacagatg
ctcacaggaggctggtggtttgatgcctgcggtccttccaacctgaacggaatgtactac
ccacagaggcagaacacaaataaattcaatggtattaagtggtactactggaaagggtcg
ggctactcgctcaaggccaccaccatgatgatccggccagcagatttctaa

DBGET integrated database retrieval system