KEGG   Sus scrofa (pig): 396755Help
Entry
396755            CDS       T01009                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04520  Adherens junction
ssc04910  Insulin signaling pathway
ssc04913  Ovarian steroidogenesis
ssc04923  Regulation of lipolysis in adipocytes
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease (NAFLD)
ssc04960  Aldosterone-regulated sodium reabsorption
Module
ssc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    396755 (INSR)
   04015 Rap1 signaling pathway
    396755 (INSR)
   04010 MAPK signaling pathway
    396755 (INSR)
   04066 HIF-1 signaling pathway
    396755 (INSR)
   04068 FoxO signaling pathway
    396755 (INSR)
   04072 Phospholipase D signaling pathway
    396755 (INSR)
   04022 cGMP - PKG signaling pathway
    396755 (INSR)
   04151 PI3K-Akt signaling pathway
    396755 (INSR)
   04152 AMPK signaling pathway
    396755 (INSR)
   04150 mTOR signaling pathway
    396755 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    396755 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    396755 (INSR)
   04923 Regulation of lipolysis in adipocyte
    396755 (INSR)
   04913 Ovarian Steroidogenesis
    396755 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    396755 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    396755 (INSR)
   04213 Longevity regulating pathway - multiple species
    396755 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    396755 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    396755 (INSR)
   04931 Insulin resistance
    396755 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    396755 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:ssc04090]
    396755 (INSR)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396755 (INSR)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   396755 (INSR)
CD molecules [BR:ssc04090]
 Proteins
  396755 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 396755
NCBI-ProteinID: XP_020939599
Ensembl: ENSSSCG00000013564
Vega: OTTSUSG00000003509
Position
2
AA seq 1382 aa AA seqDB search
MGAGGRRGAAALPLLVAVAALLVSAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGAVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TIINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFETEGSQKHNQSEYEESSGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFIPRKSSSGPAAEDARPSRKRRALGDVGNITAAVPTIPGF
SNTSSTSTPTSSEEHRPFEKVVNRESLVISGLRHFTGYRIELQACNQDAPEERCSVAAYV
SARTMPEAKADDIIGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIVKGEPETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMESVPLDRSSHSQREEAGGRDGGSALGLKRNYEEHISYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctgggggcaggcggggggcggcggccctgccgctgctggtggccgttgccgcg
ctgctggtgagcgccgcgggccacctgtaccctggagaggtgtgcccagggatggatatc
cggaataaccttacacggctgcacgagttggccaactgctcggtcatcgaaggacatttg
cagatcctgttgatgttcaaaacgcggcccgaggatttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctacgggctggagagcctgaag
gacctgttccccaacctcaccgtcatccggggctcacgcctcttctttaactatgcgctg
gtcatctttgagatggttcacttgaaggagcttggcctctacaatttgatgaacatcacc
aggggtgctgtccgcatcgagaagaacaatgagctctgctacctggcgaccattgactgg
tcgcgcatcctggactctgtggaggataattacattgtgctgaacaaagacgacaacgag
gagtgtggggacatttgcccaggcactgcgaagggcaagaccaattgccctgccaccgtc
atcaatgggcaatttgtcgagcggtgttggacgcacagtcactgccagaaagtgtgcccg
accatctgtaagtcgcacggctgcactgctgagggcctctgctgtcacagcgagtgtttg
ggcaactgctctgagccagacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcagatgcgtggagacctgcccgcccccctactaccacttccaagactggcgctgc
gtgaacttcagcttctgccaggacctgcacaacaaatgcaagaactcaaggaggcagggc
tgccaccagtacgtcattcacaacaacaagtgtatccctgagtgcccctcagggtacacg
atgaattccagcaacttgatgtgcactccgtgcctaggcccctgtcccaaagtgtgtcac
ctcctggaaggcgagaagaccatcgactcagtgacatccgcccaggagctccgaggctgc
accattatcaacgggagcctaatcatcaacattcgaggaggcaacaacctggcagccgaa
ctagaggccaaccttggactcattgaggagatttcagggtacctgaaaatccgccgatcc
tatgccctcgtgtcactttccttcttccggaagttgcgtctgatccgaggggagacgttg
gaaattgggaactattctttctatgccttggacaaccagaacctaaggcaactgtgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccattataatcccaaa
ctctgcttgtcggaaattcacaagatggaggaagtttctggaaccaaggggcgccaggag
agaaatgatattgccctgaagaccaatggggaccaggcgtcctgtgaaaatgagttactt
aaattttcttacattcggacatcttatgacaagatcttgctgaagtgggagccgtattgg
ccccccgacttccgagacctcctggggttcatgctcttctacaaagaggccccttatcag
aacgtgacggagtttgacgggcaggatgcgtgtggctccaacagctggacggtggtggac
attgacccgcctacgaggtccaatgaccccaagtcccagaaccatcctgggtggctgatg
cgtggtctcaagccctggacccagtatgccatctttgtcaagactttggtcaccttttct
gatgaacgacgcacctatggagccaagagtgacatcatctacgtccagacagatgccaca
aatccttccgtccccctggatcccatctcggtttctaattcctcgtcccagatcattctg
aagtggaagcccccctctgaccccaacggcaacatcacacactacctggtgttctgggag
aggcaggcggaggacagtgagctgtatgaactggattattgcctcaaagggttgaagctg
ccctcccggacctggtccccaccattcgagactgaggggtcccagaagcacaatcagagt
gagtacgaggaatcctctggggaatgctgctcctgcccaaagaccgactcacagatcctc
aaggagctggaggaatcatcattcaggaaaacgtttgaagattacctacacaatgtggta
ttcatccccagaaaatcctcttcaggccctgctgccgaggacgctaggccatccaggaaa
cgcagggcccttggtgacgtggggaacataacggcggccgtgcccaccattccgggtttc
tccaacacctcctccaccagcactcccacgagctcagaggagcacagaccctttgagaag
gtggtgaacagagagtcactggtcatctctggcctgcgtcacttcactggctatcgcatt
gagctgcaggcttgcaaccaagatgcccccgaagagaggtgcagtgtggctgcgtatgtc
agcgccaggaccatgcctgaagccaaggcagatgatatcattggccctgtgacccatgaa
atcttcgagaacaacgtcgttcacttgatgtggcaggagccgaaggaacccaatggtctg
attgtgctgtacgaagtgagttaccgacgatacggtgatgaggagctgcatctctgcgtc
tcccgcaggcattttgctctggagcgaggctgcaggctacgcgggctgccacctgggaat
tacagcgttcgagttcgggccacctccctggcgggtaatggctcctggacagaggccacc
tatttctacgtgacagactatttagacgtcccatcaaatattgcaaaaattatcattggc
cccctcatctttgtctttctcttcagtgttgtgattggaagcatttatctattcctgagg
aagaggcagccggatgggccactgggaccattgtatgcttcttcgaaccccgagtacctc
agtgccagcgatgtatttccatgttctgtgtacgtgccggacgagtgggaggtgcctcgg
gagaagatcacgctcctgcgcgagctggggcagggctccttcggcatggtgtacgaggga
aacgccagggacatcgtcaagggtgagccggagacccgtgtggcggtgaagacggtcaac
gagtcggccagcctgcgagagcggatcgagtttctcaacgaggcctccgtcatgaagggc
ttcacctgccaccatgtggtccgcctcctgggggtggtgtccaaaggccagccaacactg
gtggtgatggagttgatggctcacggagacttaaagagttacctgcgttccctgcggccg
gaggctgagaataaccccggccgccctccccctaccctgcaagagatgattcagatggca
gcagagattgctgatgggatggcatacctgaacgccaagaagtttgtacaccgggacctc
gccgcacgaaattgcatggtcgcccatgattttaccgtcaaaatcggagactttggaatg
accagagacatctacgaaacggattactaccggaaagggggcaagggtctactgcccgtg
cgatggatggcacccgaatccctgaaggacggggtctttaccacttcttccgacatgtgg
tcctttggcgtcgtcctttgggaaattaccagcttggcagaacagccttaccaaggcctt
tcaaacgagcaggtgttgaaatttgtcatggatggaggctatctggatcaacctgacaat
tgtccagagagagtcaccgacctgatgcgcatgtgctggcagttcaaccccaagatgcgg
ccgaccttcctggagattgttgacctgctcaaggacgacctgcaccccagctttcccgaa
gtctccttcttccacagcgaggagaacaaagcacccgagagcgaggagctggagatggag
tttgaggacatggagagcgtccccctggaccggtcctcacactcgcagagggaggaggcc
gggggtcgggatggagggtccgcgctggggctaaagaggaactatgaggagcacatctcc
tacacccacatgaacggaggcaagaaaaatggccggattctgactctgccccggtcaaat
ccttcctaa

DBGET integrated database retrieval system