KEGG   Sus scrofa (pig): 396892Help
Entry
396892            CDS       T01009                                 

Gene name
PGA5
Definition
(RefSeq) pepsin A preproprotein
  KO
K06002  pepsin A [EC:3.4.23.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    396892 (PGA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    396892 (PGA5)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.1  pepsin A
     396892 (PGA5)
Peptidases and inhibitors [BR:ssc01002]
 Aspartic peptidases
  Family A1: pepsin family
   396892 (PGA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N A1_Propeptide Asp_protease_2
Motif
Other DBs
NCBI-GeneID: 396892
NCBI-ProteinID: NP_999038
Ensembl: ENSSSCG00000013092
UniProt: A1YM35
Structure
PDB: 

Position
2
AA seq 385 aa AA seqDB search
MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKHFPEAAALI
GDEPLENYLDTEYLGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDS
STFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSSLYYAPFDGIL
GLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNW
VPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENS
DGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWIL
GDVFIRQYYTVFDRANNKVGLAPVV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctactgctgctcagcttggtggtgctctccgagtgcctcgtcaaggtcccg
ctggtcaggaagaagtccttgaggcagaacctgatcaagaatggcaagctgaaggacttc
ctgaagacccacaaacacaacccggccagcaagcacttccccgaggccgctgccctgata
ggcgatgagccccttgagaactacctggatactgagtacctcggcaccatcggcattgga
acccccgctcaggacttcaccgtcatctttgacaccggctcctccaacctgtgggtgccc
tctgtctactgctctagtctcgcctgcagcgaccacaaccagttcaaccctgatgactcc
tccaccttcgaggccaccagccaggagctgtccatcacctatggcaccggtagcatgaca
ggcatccttggatacgacaccgtccaggtcggaggcatcagcgacaccaaccagatcttt
ggcctgagcgagacagagcccggctcctccctgtactacgcccccttcgacggcatcctg
ggtctggcctaccccagcatctccgcctccggggccacccctgtctttgacaacctgtgg
gaccagggcctggtttcccaagacctcttctccgtctacctgagctccaatgacgatagc
ggcagcgtggtgttgttgggcggcatcgattcttcttactacacaggaagcctgaactgg
gtgcctgtttccgtcgagggttactggcagattaccttggacagcatcaccatggacgga
gagaccatcgcttgcagcggtggctgccaggccattgtggacacgggcacctctctgctg
accggccccaccagtgccattgccaacatccagagcgacatcggagccagcgagaactca
gatggcgagatggtgatcagctgctcctccatcgacagcctgcctgacatcgtcttcacc
atcaacggtgtccagtaccctctgagccccagtgcctacatcctgcaggacgatgacagc
tgcaccagcggcttcgagggcatggatgtccccacctcctccggagagctctggatcctg
ggtgacgtcttcatccgccagtactacaccgtctttgacagggccaacaacaaggtcggc
ctggctcccgtggtctga

DBGET integrated database retrieval system