KEGG   Sus scrofa (pig): 396894Help
Entry
396894            CDS       T01009                                 

Gene name
MDH1
Definition
(RefSeq) malate dehydrogenase, cytoplasmic
  KO
K00025  malate dehydrogenase [EC:1.1.1.37]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00020  Citrate cycle (TCA cycle)
ssc00270  Cysteine and methionine metabolism
ssc00620  Pyruvate metabolism
ssc00630  Glyoxylate and dicarboxylate metabolism
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc04964  Proximal tubule bicarbonate reclamation
Module
ssc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    396894 (MDH1)
   00620 Pyruvate metabolism
    396894 (MDH1)
   00630 Glyoxylate and dicarboxylate metabolism
    396894 (MDH1)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    396894 (MDH1)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    396894 (MDH1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     396894 (MDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N DUF4809
Motif
Other DBs
NCBI-GeneID: 396894
NCBI-ProteinID: NP_999039
UniProt: P11708 A0A480JV95
Structure
PDB: 

Position
3
AA seq 334 aa AA seqDB search
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKN
VIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKL
SSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIV
EGLPINDFSREKMDLTAKELAEEKETAFEFLSSA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccaatcagagtgcttgtgactggagcagctggtcagattgcatattcactg
ctgtacagtattggaaatggatctgtcttcggtaaagaccagcctatcatccttgtgctg
ttggatatcacccctatgatgggtgtcctggatggtgtcctgatggagctgcaggactgt
gcccttcccctcctgaaagatgtcattgcaacagataaagaagagattgccttcaaagac
ctggacgttgccattctcgtgggttccatgccaagaagggatggcatggagaggaaagat
ttactcaaagcaaatgtgaaaatcttcaaatgccagggtgctgccttggacaaatatgct
aagaagtcagttaaggttatcgtggtgggaaacccagccaataccaactgcctgactgcc
tccaagtcggctccatccattcccaaggagaacttcagctgcttgactcgtttggatcac
aaccgagctaaagcacagattgctctcaaacttggtgtgacttctgatgatgtcaagaat
gtcatcatctggggaaaccattcctcaactcagtatccagatgtcaaccatgccaaggtg
aaactgcaggcaaaggaagttggtgtttatgaagctgtgaaggatgacagctggctcaag
ggagagttcatcacgactgtgcagcagcgcggtgctgctgtcatcaaggctcgaaaactg
tccagtgcaatgtctgcggcaaaagccatttgtgaccatgtcagagacatctggtttgga
accccagagggagagtttgtgtccatgggcattatctctgatggcaactcctatggtgtt
cctgatgatctgctctactcattccctgttacaatcaaggataagacctggaaaattgtt
gaaggtctccctattaatgatttctctcgtgagaagatggacctcactgcaaaggaacta
gcagaagaaaaagaaactgcatttgaatttctttcctctgcctga

DBGET integrated database retrieval system